Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.45
PubTator Score 0.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
psoriasis 6694 3.1e-27
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 1.2
Disease Target Count Z-score Confidence
Cataract 8 multiple types 33 4.584 2.3

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.700 3.1e-27

Synonym

Accession Q5SYC1 B3KTG5 B4DHL0 C8UZT4 Q5SYC0
Symbols RLBP1L2
C6orf212
C6orf213
bA160A10.4

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

Gene RIF (1)

AA Sequence

MTHLQAGLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFR      1 - 70
LLAQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAI     71 - 140
LLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHAL    141 - 210
YTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPPYDMGTWARTLLDHEYDDDSEYNVDS    211 - 280
YSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSLD                           281 - 327
//

Text Mined References (6)

PMID Year Title