Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.45
PubTator Score 0.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Prostate cancer 172 1.0
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.700 0.000

Synonym

Accession Q5SYC1 B3KTG5 B4DHL0 C8UZT4 Q5SYC0
Symbols RLBP1L2
C6orf212
C6orf213
bA160A10.4

Gene

 GO Process (1)

Gene RIF (1)

PMID Text
19651769 Clavesin protein family appears to provide a unique neuron-specific regulation of late endosome/lysosome morphology.

AA Sequence

MTHLQAGLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFR      1 - 70
LLAQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAI     71 - 140
LLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHAL    141 - 210
YTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPPYDMGTWARTLLDHEYDDDSEYNVDS    211 - 280
YSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSLD                           281 - 327
//

Text Mined References (6)

PMID Year Title
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
19651769 2009 The clavesin family, neuron-specific lipid- and clathrin-binding Sec14 proteins regulating lysosomal morphology.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.