Property Summary

NCBI Gene PubMed Count 10
Grant Count 3
R01 Count 2
Funding $648,135.9
PubMed Score 8.18
PubTator Score 3.32

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.500 0.000
lung carcinoma 3.200 0.000
pituitary cancer 1.500 0.000

Gene RIF (4)

PMID Text
25786224 G allele at rs4878712 in FRMPD1 was associated with lower HIV-1 acquisition. G allele at this SNP was also associated with reduced FBXO10 and increased BCL2 expression levels, whereas higher BCL2 levels are known to reduce HIV replication and infectivity.
23318951 LGN-TPR motifs are versatile and capable of recognizing multiple targets via diverse binding modes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18566450 The PDZ and band 4.1 containing protein Frmpd1 regulates the subcellular location of activator of G-protein signaling 3 and its interaction with G-proteins.

AA Sequence

MEELETSLFQTRKAHRIEQMVARWLRRSRDSSARAKVAAADGPARNPTQTLIPVRHTVKIDKDTLLQDYG      1 - 70
FHISESLPLTVVAVTAGGSAHGKLFPGDQILQMNNEPAEDLSWERAVDILREAEDSLSITVVRCTSGVPK     71 - 140
SSFLTEEKRARLKTNPVKVHFAEEVLISGHSQGNSLLCMPNVLKLYLENGQTKAFKFEANTTVKDIILTV    141 - 210
KEKLSIRSIEYFALALEEQYSISRLHLLHEEELIQQVVEREESHDYRCLFRVCFVPKDPLDLLKEDPVAF    211 - 280
EYLYLQSCSDVLQERFAVEMKCSSALRLAALHIQERIYACAQPQKISLKYIEKDWGIENFISPTLLRNMK    281 - 350
GKDIKKAISFHMKRNQNLLEPRQKQLISAAQLRLNYLQILGELKTYGGRIFNATLMLQDRESYIALLVGA    351 - 420
KYGISQVINSKLNIMSTLAEFANISRVELTEESEKVSVVKVYLQDVKVLTLLLESNSAKDLACLIAGYYR    421 - 490
LLVDPVTSIFLWPGNKQQAHRVSAEEGYESRACSDSEESSEVDCVLEPLSDRRLVKLAPCRSLIKEEQPP    491 - 560
GNSPTPEVARRGPSTCGASSTTDSAESEASDSANTESRGYRTSGSSESMDALEEDDLDTCSSSRSTFFHF    561 - 630
GSPGLAESIDSDSQEERSGIETSGFLCLLDLAQRANPQCQKTEFSESAALETFGWAPELSTVRLDPRLYE    631 - 700
GSHADYYSLCSSVSPASYLSDSSESTASRQGGAPPAWGQQGWTEAQPSSMLEPLALHPPLAFEDGSSDEE    701 - 770
YYDAADKLTPPGPPSGPRDVSTAEPSATSLQNKASTSSPENSLPCGPDGRQPSRRGGVKKYAKTLRKRRS    771 - 840
FLQTDYTSQVSFPLVPSASLESVDDVCYYDREPYLALGAPSPTVSSLQDMQGEPGLLETKALGLLAPLRE    841 - 910
TKSTNPASRVMEMEPETMETKSVIDSRVSSISAIRFRIDPNNKENSGVVPAASSSASTPHCSNPGSSGPD    911 - 980
TAQARPSQILPLSQDLDGIAPKEPTIEHGDSSFSLSSGDPNPDRACLASNPGLNNVSQGDTLELQLEPHV    981 - 1050
QLEMGLESFCTNHIQETAPKYTEPLLSPRDEPRSDECGINPGEKIASIPTKEEPQGQLSLERDREVTNKN   1051 - 1120
GTNVFQEESRKDSGDSPGDVSNNVSQTLDISSPAGKIVTSLSLDAPVTGTEQIPPHPPRDPQGQSREPPG   1121 - 1190
QGCQAQEQKLFVELDLDPDFFLGKQTVSPAVPPEGIKAEAPNHVTGQDIAPRDSPEWVCFNPEPSLPEPL   1191 - 1260
PCPQEDPHLETSNHCLLSEGKSDSSSICLSAEKSFLCFAPESHPEVSASLRVATSLGFAGMNEMVAPRIG   1261 - 1330
MDQCSCQFSYATCFRGPQPETEEEDRDLEAHPMAPLTSPPSAGSPVVLPWRPARAHSCTTAPLSRKSHIW   1331 - 1400
PEYCSRALRQLKATPASTPEGFIQLMESLLELQDILETSWGVGNKHPPEKCTWHFTESRSRLCMGSQKLL   1401 - 1470
SSCRHVIRMDQSPEEMQGAVRDTFQHLVQLAGLCFQFTDCSRCSARHREAAGNLRDVVYTYHQFIEAAKS   1471 - 1540
TCERGYHDLSVKLLARQCTALTAAVFCLTQKFRASTAL                                   1541 - 1578
//

Text Mined References (15)

PMID Year Title
25786224 2015 Novel genetic locus implicated for HIV-1 acquisition with putative regulatory links to HIV replication and infectivity: a genome-wide association study.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23318951 2013 Structural and biochemical characterization of the interaction between LGN and Frmpd1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18566450 2008 The PDZ and band 4.1 containing protein Frmpd1 regulates the subcellular location of activator of G-protein signaling 3 and its interaction with G-proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17404222 2007 Rat Mcs5a is a compound quantitative trait locus with orthologous human loci that associate with breast cancer risk.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...