Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.14
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 2.7e-03

AA Sequence

MNIPLGEKVMLDIVAMFRQYSGDDGRMDMPGLVNLMKENFPNFLSGCEKSDMDYLSNALEKKDDNKDKKV      1 - 70
NYSEFLSLLGDITIDHHKIMHGVAPCSGGSQ                                            71 - 101
//

Text Mined References (3)

PMID Year Title