Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.003

Synonym

Accession Q5SY13
Symbols C9orf104
bA54A22.4

Gene

 Compartment GO Term (0)

AA Sequence

MRRPWEKKEATRNPIAEVLARKKRTEELISLQEHGSRKQKIKEASISWAETSRQIG                    1 - 56
//

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.