Property Summary

NCBI Gene PubMed Count 5
PubMed Score 8.91
PubTator Score 138.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Keratoconjunctivitis sicca 25 3.024 1.5

Expression

Synonym

Accession Q5SXM8 B2RUX5 B9EJE1
Symbols HEP
HEP1
ZIM17
TIMM15
C9orf151
bA413M3.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MLRTALRGAPRLLSRVQPRAPCLRRLWGRGARPEVAGRRRAWAWGWRRSSSEQGPGPAAALGRVEAAHYQ      1 - 70
LVYTCKVCGTRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSDLNGKRNIEEILTARGEQVHRVA     71 - 140
GEGALELVLEAAGAPTSTAAPEAGEDEGPPSPGKTEPS                                    141 - 178
//

Text Mined References (8)

PMID Year Title