Property Summary

NCBI Gene PubMed Count 5
Grant Count 10
R01 Count 6
Funding $531,105.78
PubMed Score 9.83
PubTator Score 138.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Keratoconjunctivitis sicca 19 3.031 1.5

Expression

Gene RIF (3)

PMID Text
23462535 The results indicate that hHep1 shares some structural similarities with the yeast ortholog despite the low identity and functional differences.
22162012 DNLZ/HEP zinc-binding subdomain is critical for regulation of the mitochondrial chaperone HSPA9. Human DNLZ partially complements the growth of Deltazim17 Saccharomyces cerevisiae.
21530495 These findings implicate a conserved histidine as critical for DNLZ regulation of mitochondrial HSPA9 catalytic activity.

AA Sequence

MLRTALRGAPRLLSRVQPRAPCLRRLWGRGARPEVAGRRRAWAWGWRRSSSEQGPGPAAALGRVEAAHYQ      1 - 70
LVYTCKVCGTRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSDLNGKRNIEEILTARGEQVHRVA     71 - 140
GEGALELVLEAAGAPTSTAAPEAGEDEGPPSPGKTEPS                                    141 - 178
//

Text Mined References (8)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23462535 2013 Structural and stability studies of the human mtHsp70-escort protein 1: an essential mortalin co-chaperone.
22162012 2012 The DNLZ/HEP zinc-binding subdomain is critical for regulation of the mitochondrial chaperone HSPA9.
21530495 2011 A conserved histidine in human DNLZ/HEP is required for stimulation of HSPA9 ATPase activity.
18632665 2008 The human escort protein Hep binds to the ATPase domain of mitochondrial hsp70 and regulates ATP hydrolysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.