Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 2.06120673765055E-15
astrocytoma 1493 2.33985593119476E-14
glioblastoma 5572 1.53774133107821E-7
osteosarcoma 7933 4.47157836588449E-7
posterior fossa group A ependymoma 1511 3.02461483488836E-6
group 4 medulloblastoma 1875 2.79186329461931E-5
primitive neuroectodermal tumor 3031 2.88984478878622E-5
atypical teratoid/rhabdoid tumor 1095 2.99196755529197E-5
pilocytic astrocytoma 3086 2.25945249809956E-4
pediatric high grade glioma 2712 4.44185665733978E-4
nasopharyngeal carcinoma 1056 0.00102232791623372
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00108703588953382
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.011425972861586
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0170018323542449
Pick disease 1893 0.0242950229370704
Breast cancer 3099 0.0330693528274578
active Crohn's disease 918 0.0435524897993895
interstitial lung disease 292 0.0464576448333567
Disease Target Count Z-score Confidence
Mental depression 58 0.0 2.0

Expression

Synonym

Accession Q5SXM1 Q8IVQ9
Symbols

Gene

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (3)

PMID Text
20846217 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGTISLCIGVCAFEGANTSTSFYKLVYTAILSYSIQDLLPEQDMKDLCQKVTLTRHRSWGLDNLHLVKDW      1 - 70
RTVNEGKGQKEYCNRLTQCSSTKSKIFQCIECGRNFSWRSILTEHKRIHTGEKPYKCEECGKVFNRCSNL     71 - 140
TKHKRIHTGEKPYKCDECGKVFNWWSQLTNHKKIHTGEKPYKCDECDKVFNWWSQLTSHKKIHSGEKPYP    141 - 210
CEECGKAFTQFSNLTQHKRIHTGEKPYKCKECCKAFNKFSNLTQHKRIHTGEKPYKCEECGNVFNECSHL    211 - 280
TRHRRIHTGEKPYKCEECGKAFTQFASLTRHKRIHTGEKPYQCEECGKTFNRCSHLSSHKRIHTGEKPYK    281 - 350
CEECGRTFTQFSNLTQHKRIHTGEKPYKCKECGKAFNKFSSLTQHRRIHTGVKPYKCEECGKVFKQCSHL    351 - 420
TSHKRIHTGEKPYKCKECGKAFYQSSILSKHKRIHTEEKPYKCEECGKAFNQFSSLTRHKRIHTGEKRYK    421 - 490
CKECGKGFYQSSIHSKYKRIYTGEEPDKCKKCGSL                                       491 - 525
//

Text Mined References (8)

PMID Year Title
20846217 2010 Association of linear growth impairment in pediatric Crohn's disease and a known height locus: a pilot study.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18391952 2008 Genome-wide association analysis identifies 20 loci that influence adult height.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.