Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.43
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 2.758 5.9e-03
active ulcerative colitis 2.879 5.7e-03
Breast cancer -2.000 1.5e-10
intraductal papillary-mucinous neoplasm ... 1.400 2.3e-02
lung adenocarcinoma 1.200 3.8e-03
lung carcinoma -1.700 1.1e-03
malignant mesothelioma 1.900 6.8e-07
nasopharyngeal carcinoma -2.200 2.1e-05
osteosarcoma -2.525 2.7e-08
ovarian cancer 1.500 4.3e-02

Synonym

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

Gene RIF (2)

AA Sequence

MAGGKQFTFSYENEVCKQDYFIKSPPSQLFSSVTSWKKRFFILSKAGEKSFSLSYYKDHHHRGSIEIDQN      1 - 70
SSVEVGISSQEKMQSVQKMFKCHPDEVMSIRTTNREYFLIGHDREKIKDWVSFMSSFRQDIKATQQNTEE     71 - 140
ELSLGNKRTLFYSSPLLGPSSTSEAVGSSSPRNGLQDKHLMEQSSPGFRQTHLQDLSEATQDVKEENHYL    141 - 210
TPRSVLLELDNIIASSDSGESIETDGPDQVSGRIECHYEPMESYFFKETSHESVDSSKEEPQTLPETQDG    211 - 280
DLHLQEQGSGIDWCLSPADVEAQTTNDQKGSASLTVVQLSILINNIPDESQVEKLNVFLSPPDVINYLAL    281 - 350
TEATGRICVSQWEGPPRLGCIFCHGDHLLAVNDLKPQSLEEVSLFLTRSIQKEKLKLTIGRIPNSETFHA    351 - 420
ASCMCPSKCQSAAPSQLDKPRLNRAPKRSPAIKKSQQKGARE                                421 - 462
//

Text Mined References (10)

PMID Year Title