Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.83
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
osteosarcoma -2.525 0.000
intraductal papillary-mucinous neoplasm ... 1.400 0.023
active Crohn's disease 2.758 0.006
active ulcerative colitis 2.879 0.006
lung adenocarcinoma 1.200 0.004
nasopharyngeal carcinoma -2.200 0.000
lung carcinoma -1.700 0.001
Breast cancer -2.000 0.000
ovarian cancer 1.500 0.043

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAGGKQFTFSYENEVCKQDYFIKSPPSQLFSSVTSWKKRFFILSKAGEKSFSLSYYKDHHHRGSIEIDQN      1 - 70
SSVEVGISSQEKMQSVQKMFKCHPDEVMSIRTTNREYFLIGHDREKIKDWVSFMSSFRQDIKATQQNTEE     71 - 140
ELSLGNKRTLFYSSPLLGPSSTSEAVGSSSPRNGLQDKHLMEQSSPGFRQTHLQDLSEATQDVKEENHYL    141 - 210
TPRSVLLELDNIIASSDSGESIETDGPDQVSGRIECHYEPMESYFFKETSHESVDSSKEEPQTLPETQDG    211 - 280
DLHLQEQGSGIDWCLSPADVEAQTTNDQKGSASLTVVQLSILINNIPDESQVEKLNVFLSPPDVINYLAL    281 - 350
TEATGRICVSQWEGPPRLGCIFCHGDHLLAVNDLKPQSLEEVSLFLTRSIQKEKLKLTIGRIPNSETFHA    351 - 420
ASCMCPSKCQSAAPSQLDKPRLNRAPKRSPAIKKSQQKGARE                                421 - 462
//

Text Mined References (9)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.