Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.20
PubTator Score 4.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 4.16779742223835E-10
osteosarcoma 7933 2.38316038595677E-9
acute quadriplegic myopathy 1157 3.46718717405273E-8
primitive neuroectodermal tumor 3031 1.88913443132289E-4
ovarian cancer 8492 6.76226323993209E-4
lung cancer 4473 0.00105133043738335
breast carcinoma 1614 0.00141307370476325
glioblastoma 5572 0.00885714732948847
Disease Target Count Z-score Confidence
primary open angle glaucoma 12 3.193 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -2.420 0.000
ependymoma 1.200 0.000
glioblastoma 1.100 0.009
primitive neuroectodermal tumor 1.100 0.000
acute quadriplegic myopathy 1.178 0.000
lung cancer 1.300 0.001
breast carcinoma 1.500 0.001
ovarian cancer 1.200 0.001

Synonym

Accession Q5SWX8 B4DNY0 E9PFR7 Q19CC6 Q8WYB6 Q9BTS2 Q9H6A6 Q9NX06 hODR-4
Symbols ODR4
TTG1
odr-4

Gene

PANTHER Protein Class (2)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
18187418 LMO2, TAL1, Ttg-1, and SIL support levels of V(D)J recombination above background levels in cell culture and are also cleaved by the RAG proteins, while Hox11 and SCL are nicked but not cleaved efficiently in vitro

AA Sequence

MGRTYIVEETVGQYLSNINLQGKAFVSGLLIGQCSSQKDYVILATRTPPKEEQSENLKHPKAKLDNLDEE      1 - 70
WATEHACQVSRMLPGGLLVLGVFIITTLELANDFQNALRRLMFAVEKSINRKRLWNFTEEEVSERVTLHI     71 - 140
CASTKKIFCRTYDIHDPKSSARPADWKYQSGLSSSWLSLECTVHINIHIPLSATSVSYTLEKNTKNGLTR    141 - 210
WAKEIENGVYLINGQVKDEDCDLLEGQKKSSRGNTQATSHSFDVRVLTQLLLNSDHRSTATVQICSGSVN    211 - 280
LKGAVKCRAYIHSSKPKVKDAVQAVKRDILNTVADRCEMLFEDLLLNEIPEKKDSEKEFHVLPYRVFVPL    281 - 350
PGSTVMLCDYKFDDESAEEIRDHFMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPI    351 - 420
KTTMLLKIQQNIGVIAAFTVAVLAAGISFHYFSD                                        421 - 454
//

Text Mined References (11)

PMID Year Title
24603482 2014 An ER complex of ODR-4 and ODR-8/Ufm1 specific protease 2 promotes GPCR maturation by a Ufm1-independent mechanism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
18187418 2008 V(D)J recombinase binding and cleavage of cryptic recombination signal sequences identified from lymphoid malignancies.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15718105 2005 Ubiquitously expressed GPCR membrane-trafficking orthologs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12868032 2003 Protein expression, genomic structure, and polymorphisms of oculomedin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...