Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Disease Target Count
Quebec platelet disorder 2

Expression

Gene RIF (3)

AA Sequence

MFLHLDSHSSLERTKPTVVGVDTHMELDEVHCCPGRDSGGGFIKGPMLQGLQGEGKLAPIPKPTLPSPSR      1 - 70
LTLFVSSSQMEDHGFPARRNGLTQASFIYQMPAGWGSPGGLFLPCQPVPTPVVLKPPLPPCPISWGESGP     71 - 140
AVDGIRRTPAP                                                               141 - 151
//

Text Mined References (8)

PMID Year Title