Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.54
PubTator Score 0.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 5.7e-05
ovarian cancer 1.400 1.7e-02
tuberculosis and treatment for 6 months -1.100 4.5e-03

AA Sequence

MLRFIQKFSQASSKILKYSFPVGLRTSRTDILSLKMSLQQNFSPCPRPWLSSSFPAYMSKTQCYHTSPCS      1 - 70
FKKQQKQALLARPSSTITYLTDSPKPALCVTLAGLIPFVAPPLVMLMTKTYIPILAFTQMAYGASFLSFL     71 - 140
GGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISERLSEAIVTVIMGMGVAFHLELFLLPHYPNW    141 - 210
FKALRIVVTLLATFSFIITLVVKSSFPEKGHKRPGQV                                     211 - 247
//

Text Mined References (5)

PMID Year Title