Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.54
PubTator Score 0.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
medulloblastoma, large-cell 6234 5.695319719182E-5
tuberculosis and treatment for 6 months 686 0.00451289304937435
ovarian cancer 8492 0.0167031504870282

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000
tuberculosis and treatment for 6 months -1.100 0.005
ovarian cancer 1.400 0.017

Synonym

Accession Q5SWH9 Q3SWW5 Q7Z2G0 Q9P0P9
Symbols C1orf154

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MLRFIQKFSQASSKILKYSFPVGLRTSRTDILSLKMSLQQNFSPCPRPWLSSSFPAYMSKTQCYHTSPCS      1 - 70
FKKQQKQALLARPSSTITYLTDSPKPALCVTLAGLIPFVAPPLVMLMTKTYIPILAFTQMAYGASFLSFL     71 - 140
GGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISERLSEAIVTVIMGMGVAFHLELFLLPHYPNW    141 - 210
FKALRIVVTLLATFSFIITLVVKSSFPEKGHKRPGQV                                     211 - 247
//

Text Mined References (5)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.