Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.54
PubTator Score 0.39

Knowledge Summary


No data available


  Disease (1)


  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 5.7e-05
ovarian cancer 1.400 1.7e-02
tuberculosis and treatment for 6 months -1.100 4.5e-03


Accession Q5SWH9 Q3SWW5 Q7Z2G0 Q9P0P9
Symbols C1orf154


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

FKALRIVVTLLATFSFIITLVVKSSFPEKGHKRPGQV                                     211 - 247

Text Mined References (5)

PMID Year Title