Property Summary

NCBI Gene PubMed Count 17
PubMed Score 25.77
PubTator Score 10.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.600 1.3e-02
acute myeloid leukemia 1.500 2.0e-03
interstitial lung disease -1.700 1.1e-02
non primary Sjogren syndrome sicca 1.200 2.8e-02
ovarian cancer 1.300 1.3e-02
pancreatic ductal adenocarcinoma liver m... -1.289 2.0e-02

Gene RIF (4)

AA Sequence

MEPGTGGSRKRLGPRAGFRFWPPFFPRRSQAGSSKFPTPLGPENSGNPTLLSSAQPETRVSYWTKLLSQL      1 - 70
LAPLPGLLQKVLIWSQLFGGMFPTRWLDFAGVYSALRALKGREKPAAPTAQKSLSSLQLDSSDPSVTSPL     71 - 140
DWLEEGIHWQYSPPDLKLELKAKGSALDPAAQAFLLEQQLWGVELLPSSLQSRLYSNRELGSSPSGPLNI    141 - 210
QRIDNFSVVSYLLNPSYLDCFPRLEVSYQNSDGNSEVVGFQTLTPESSCLREDHCHPQPLSAELIPASWQ    211 - 280
GCPPLSTEGLPEIHHLRMKRLEFLQQANKGQDLPTPDQDNGYHSLEEEHSLLRMDPKHCRDNPTQFVPAA    281 - 350
GDIPGNTQESTEEKIELLTTEVPLALEEESPSEGCPSSEIPMEKEPGEGRISVVDYSYLEGDLPISARPA    351 - 420
CSNKLIDYILGGASSDLETSSDPEGEDWDEEAEDDGFDSDSSLSDSDLEQDPEGLHLWNSFCSVDPYNPQ    421 - 490
NFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSLPETPEHSSGEEDDWESSADEAESLKLWNSFC    491 - 560
NSDDPYNPLNFKAPFQTSGENEKGCRDSKTPSESIVAISECHTLLSCKVQLLGSQESECPDSVQRDVLSG    561 - 630
GRHTHVKRKKVTFLEEVTEYYISGDEDRKGPWEEFARDGCRFQKRIQETEDAIGYCLTFEHRERMFNRLQ    631 - 700
GTCFKGLNVLKQC                                                             701 - 713
//

Text Mined References (24)

PMID Year Title