Property Summary

NCBI Gene PubMed Count 16
Grant Count 6
Funding $819,653
PubMed Score 23.94
PubTator Score 10.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (4)

PMID Text
26307080 Whole-exome sequencing identified a homozygous missense mutation, c.1972G>A; p.Arg658Cys, in protein phosphatase 1, regulatory subunit 15b (PPP1R15B)
26159176 the first homozygous mutation in the PPP1R15B gene encoding the regulatory subunit of an eIF2alpha-specific phosphatase in two siblings affected by a novel syndrome of diabetes of youth with short stature, intellectual disability, and microcephaly
25325377 CIP2A regulates cancer metabolism and CREB phosphorylation in non-small cell lung cancer
22915583 the mammalian traffic machinery co-opts p-eIF2alpha and CReP, regulators of translation initiation.

AA Sequence

MEPGTGGSRKRLGPRAGFRFWPPFFPRRSQAGSSKFPTPLGPENSGNPTLLSSAQPETRVSYWTKLLSQL      1 - 70
LAPLPGLLQKVLIWSQLFGGMFPTRWLDFAGVYSALRALKGREKPAAPTAQKSLSSLQLDSSDPSVTSPL     71 - 140
DWLEEGIHWQYSPPDLKLELKAKGSALDPAAQAFLLEQQLWGVELLPSSLQSRLYSNRELGSSPSGPLNI    141 - 210
QRIDNFSVVSYLLNPSYLDCFPRLEVSYQNSDGNSEVVGFQTLTPESSCLREDHCHPQPLSAELIPASWQ    211 - 280
GCPPLSTEGLPEIHHLRMKRLEFLQQANKGQDLPTPDQDNGYHSLEEEHSLLRMDPKHCRDNPTQFVPAA    281 - 350
GDIPGNTQESTEEKIELLTTEVPLALEEESPSEGCPSSEIPMEKEPGEGRISVVDYSYLEGDLPISARPA    351 - 420
CSNKLIDYILGGASSDLETSSDPEGEDWDEEAEDDGFDSDSSLSDSDLEQDPEGLHLWNSFCSVDPYNPQ    421 - 490
NFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSLPETPEHSSGEEDDWESSADEAESLKLWNSFC    491 - 560
NSDDPYNPLNFKAPFQTSGENEKGCRDSKTPSESIVAISECHTLLSCKVQLLGSQESECPDSVQRDVLSG    561 - 630
GRHTHVKRKKVTFLEEVTEYYISGDEDRKGPWEEFARDGCRFQKRIQETEDAIGYCLTFEHRERMFNRLQ    631 - 700
GTCFKGLNVLKQC                                                             701 - 713
//

Text Mined References (22)

PMID Year Title
26307080 2015 Homozygous mutation in the eukaryotic translation initiation factor 2alpha phosphatase gene, PPP1R15B, is associated with severe microcephaly, short stature and intellectual disability.
26159176 2015 A Missense Mutation in PPP1R15B Causes a Syndrome Including Diabetes, Short Stature, and Microcephaly.
25774600 2015 G-actin provides substrate-specificity to eukaryotic initiation factor 2? holophosphatases.
25621764 2015 Translation of 5' leaders is pervasive in genes resistant to eIF2 repression.
25325377 2015 CIP2A regulates cancer metabolism and CREB phosphorylation in non-small cell lung cancer.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22915583 2012 A subunit of eukaryotic translation initiation factor 2?-phosphatase (CreP/PPP1R15B) regulates membrane traffic.
22321011 Protein phosphatase 1? interacting proteins in the human brain.
22013210 2011 The unfolded protein response: integrating stress signals through the stress sensor IRE1?.
More...