Property Summary

NCBI Gene PubMed Count 50
PubMed Score 269.90
PubTator Score 127.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
HYPERCHOLESTEROLEMIA, AUTOSOMAL RECESSIVE 1 0.0 0.0
Disease Target Count P-value
pituitary cancer 1972 1.1e-06
ovarian cancer 8520 1.2e-03
lung cancer 4740 2.5e-03
pancreatic cancer 2398 3.0e-03
osteosarcoma 7950 3.6e-03
Common variable immunodeficiency 101 1.2e-02
Disease Target Count Z-score Confidence
Familial hyperlipidemia 6 0.0 4.0

Expression

  Differential Expression (6)

Disease log2 FC p
Common variable immunodeficiency -1.046 1.2e-02
lung cancer -1.200 2.5e-03
osteosarcoma -1.144 3.6e-03
ovarian cancer 1.100 1.2e-03
pancreatic cancer -1.100 3.0e-03
pituitary cancer -2.200 1.1e-06

Protein-protein Interaction (3)

Gene RIF (31)

AA Sequence

MDALKSAGRALIRSPSLAKQSWGGGGRHRKLPENWTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAA      1 - 70
IKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQS     71 - 140
LECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKSLVATG    141 - 210
NLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQD    211 - 280
MHYAQCLSPVDWDKPDSSGTEQDDLFSF                                              281 - 308
//

Text Mined References (57)

PMID Year Title