Property Summary

NCBI Gene PubMed Count 21
PubMed Score 134.93
PubTator Score 6.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis 1.600 0.001
osteosarcoma 2.448 0.000
group 4 medulloblastoma 1.800 0.000
primitive neuroectodermal tumor 1.100 0.001
tuberculosis -1.500 0.000
lung cancer 1.400 0.000
active Crohn's disease 1.050 0.027
diabetes mellitus -1.200 0.002
primary Sjogren syndrome 1.300 0.000
gastric carcinoma 1.400 0.003
ulcerative colitis 2.000 0.000

Synonym

Accession Q5SW79 O75058 Q5SW77 Q5SW78 Q7LGA9 Q86W31 Q9UQ08 Q9UQ09 Cep170
Symbols KAB
FAM68A
KIAA0470

Gene

PDB

4JON  

Gene RIF (5)

PMID Text
23087211 Data indicate that Cep170 association with the C-terminus of Kif2b enhances localization of Kif2b to the spindle.
22190034 HIV-1 Vpr is identified to have a physical interaction with centrosomal protein 170kDa (CEP170) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19626040 Observational study of gene-disease association. (HuGE Navigator)
15616186 Cep170 interacts with Polo-like kinase 1 in mature centrioles.

AA Sequence

MSLTSWFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYDASTDEHLVKDLGSLNGTFVND      1 - 70
VRIPEQTYITLKLEDKLRFGYDTNLFTVVQGEMRVPEEALKHEKFTIQLQLSQKSSESELSKSASAKSID     71 - 140
SKVADAATEVQHKTTEALKSEEKAMDISAMPRGTPLYGQPSWWGDDEVDEKRAFKTNGKPEEKNHEAGTS    141 - 210
GCGIDAKQVEEQSAAANEEVLFPFCREPSYFEIPTKEFQQPSQITESTIHEIPTKDTPSSHITGAGHASF    211 - 280
TIEFDDSTPGKVTIRDHVTKFTSDQRHKSKKSSPGTQDLLGIQTGMMAPENKVADWLAQNNPPQMLWERT    281 - 350
EEDSKSIKSDVPVYLKRLKGNKHDDGTQSDSENAGAHRRCSKRATLEEHLRRHHSEHKKLQKVQATEKHQ    351 - 420
DQAVTSSAHHRGGHGVPHGKLLKQKSEEPSVSIPFLQTALLRSSGSLGHRPSQEMDKMLKNQATSATSEK    421 - 490
DNDDDQSDKGTYTIELENPNSEEVEARKMIDKVFGVDDNQDYNRPVINEKHKDLIKDWALSSAAAVMEER    491 - 560
KPLTTSGFHHSEEGTSSSGSKRWVSQWASLAANHTRHDQEERIMEFSAPLPLENETEISESGMTVRSTGS    561 - 630
ATSLASQGERRRRTLPQLPNEEKSLESHRAKVVTQRSEIGEKQDTELQEKETPTQVYQKDKQDADRPLSK    631 - 700
MNRAVNGETLKTGGDNKTLLHLGSSAPGKEKSETDKETSLVKQTLAKLQQQEQREEAQWTPTKLSSKNVS    701 - 770
GQTDKCREETFKQESQPPEKNSGHSTSKGDRVAQSESKRRKAEEILKSQTPKGGDKKESSKSLVRQGSFT    771 - 840
IEKPSPNIPIELIPHINKQTSSTPSSLALTSASRIRERSESLDPDSSMDTTLILKDTEAVMAFLEAKLRE    841 - 910
DNKTDEGPDTPSYNRDNSISPESDVDTASTISLVTGETERKSTQKRKSFTSLYKDRCSTGSPSKDVTKSS    911 - 980
SSGAREKMEKKTKSRSTDVGSRADGRKFVQSSGRIRQPSVDLTDDDQTSSVPHSAISDIMSSDQETYSCK    981 - 1050
PHGRTPLTSADEHVHSKLEGSKVTKSKTSPVVSGSSSKSTTLPRPRPTRTSLLRRARLGEASDSELADAD   1051 - 1120
KASVASEVSTTSSTSKPPTGRRNISRIDLLAQPRRTRLGSLSARSDSEATISRSSASSRTAEAIIRSGAR   1121 - 1190
LVPSDKFSPRIRANSISRLSDSKVKSMTSAHGSASVNSRWRRFPTDYASTSEDEFGSNRNSPKHTRLRTS   1191 - 1260
PALKTTRLQSAGSAMPTSSSFKHRIKEQEDYIRDWTAHREEIARISQDLALIAREINDVAGEIDSVTSSG   1261 - 1330
TAPSTTVSTAATTPGSAIDTREELVDRVFDESLNFRKIPPLVHSKTPEGNNGRSGDPRPQAAEPPDHLTI   1331 - 1400
TRRRTWSRDEVMGDNLLLSSVFQFSKKIRQSIDKTAGKIRILFKDKDRNWDDIESKLRAESEVPIVKTSS   1401 - 1470
MEISSILQELKRVEKQLQAINAMIDPDGTLEALNNMGFPSAMLPSPPKQKSSPVNNHHSPGQTPTLGQPE   1471 - 1540
ARALHPAAVSAAAEFENAESEADFSIHFNRFNPDGEEEDVTVQE                             1541 - 1584
//

Text Mined References (31)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23386061 2013 Kif3a interacts with Dynactin subunit p150 Glued to organize centriole subdistal appendages.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23087211 2012 The microtubule-binding protein Cep170 promotes the targeting of the kinesin-13 depolymerase Kif2b to the mitotic spindle.
22190034 2011 Global landscape of HIV-human protein complexes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
More...