Property Summary

NCBI Gene PubMed Count 18
PubMed Score 19.12
PubTator Score 9.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver neoplasms 130 0.0 0.0
Disease Target Count P-value
Astrocytoma, Pilocytic 3081 1.8e-04
invasive ductal carcinoma 2951 2.0e-03
osteosarcoma 7950 5.9e-03
Disease Target Count Z-score Confidence
Ovarian hyperstimulation syndrome 19 3.1 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 1.8e-04
invasive ductal carcinoma -1.100 2.0e-03
osteosarcoma 1.048 5.9e-03

Synonym

Accession Q5SW24 Q2NKJ2 Q569G0 Q8WYW2
Symbols DPR2
DAPPER2
C6orf116
bA503C24.7

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (14)

AA Sequence

MWTPGGPPGSAGWDRRRLGARLRAAFAGLQELQGLRATQQERVRGALALQPPPAPAAPCGPHGLHGPEQQ      1 - 70
LEAALAALQEQLSRLRQQDIGLKTHLDQLDLQISKLQLDVGTASGEALDSDSRPSSGFYEMSDGGSCSLS     71 - 140
TSCASVCSDHISPSLGSLLPVAQAHKARPSMGDWRPRSVDETTVPAWRPQATEEGARPPGSVEDAGQPWG    141 - 210
TFWPRPVSTGDLDRALPADTGLQKASADAELLGLLCQGVDIPLHVPDPKYRQDLVSQGGREVYPYPSPLH    211 - 280
AVALQSPLFVLTKETPQRGGPSFPRESPRGPAGLNTIQTGPVLEAGPARARAYIDRLLHLWGRETPAKGS    281 - 350
EGEQGPLRHAASPSPQRQGGWSTDGGGRLLVFAPGREDEGGPAQSRGAGRGGPQQQGYMPLEGPQQSGSL    351 - 420
PEEGSKPSNSCVLRETMVQASPSSKAQQTPSAQDYGRGNIISPSRMLDKSPSPASGHFAHPSFAASLKMG    421 - 490
PPKSKAEKIKRSPMDKVLRFARQPLLLLDRPEGAHAAPQPSLEWDPAHWPTGRGGLQRRPALAWEAPGRS    491 - 560
CSESTLYPMPVLVPLAVAPQESHRTSAQALFPFEASLLTSVARRKHRRWQSTVEISARARLASCPESNLG    561 - 630
PPRPVARRAGGPLARGRPSLVRQDAYTRSDSEPSKHSAECDPRFPSVIPETSEGESSDHTTNRFGDRESS    631 - 700
SSDEEGGAQSRDCDLALGYVAAGHAELAWTQEAPVSSGPLLSPVPKLCRIKASKALKKKIRRFQPTALKV    701 - 770
MTMV                                                                      771 - 774
//

Text Mined References (21)

PMID Year Title