Property Summary

NCBI Gene PubMed Count 16
Grant Count 8
R01 Count 8
Funding $281,653.38
PubMed Score 15.89
PubTator Score 9.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.048 0.006
pilocytic astrocytoma 1.200 0.000
invasive ductal carcinoma -1.100 0.002

Gene RIF (12)

PMID Text
25524937 There was no statistical difference between groups concerning DACT1 and DACT2 either in promoter hypermethylation or transcript levels. Age was associated with DACT2 promoter hypermethylation, especially over 56 years old.
25521223 This study demonstrated that Genes overexpressed in Pilomyxoid Astrocytoma vs. Pilocytic Astrocytoma, ranked according to fold-change, included developmental genes H19, DACT2,COL2A1; COL1A1 and IMP3.
25375359 DACT2 suppresses papillary thyroid cancer proliferation and metastasis by inhibiting Wnt signaling.
25023701 DACT2 acts as a functional tumor suppressor in colon cancer through inhibiting Wnt/beta-catenin signaling. Its methylation at early stages of colon carcinogenesis is an independent prognostic factor.
23803417 Loss of DACT2 expression is associated with esophageal squamous cell carcinoma.
23496880 Reduced expression of DACT2 due to methylation-mediated gene silencing promotes hepatocellular carcinoma progression
23449122 DACT2 suppresses hepatocellular carcinoma by inhibiting Wnt signaling in human hepatocellular carcinoma cells.
23244112 Hypermethylation of Dact1 gene is associated with transitional cell carcinomas.
22806826 Epigenetic regulation of DACT2 is a key component of the Wnt signalling pathway in human lung cancer.
20877624 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MWTPGGPPGSAGWDRRRLGARLRAAFAGLQELQGLRATQQERVRGALALQPPPAPAAPCGPHGLHGPEQQ      1 - 70
LEAALAALQEQLSRLRQQDIGLKTHLDQLDLQISKLQLDVGTASGEALDSDSRPSSGFYEMSDGGSCSLS     71 - 140
TSCASVCSDHISPSLGSLLPVAQAHKARPSMGDWRPRSVDETTVPAWRPQATEEGARPPGSVEDAGQPWG    141 - 210
TFWPRPVSTGDLDRALPADTGLQKASADAELLGLLCQGVDIPLHVPDPKYRQDLVSQGGREVYPYPSPLH    211 - 280
AVALQSPLFVLTKETPQRGGPSFPRESPRGPAGLNTIQTGPVLEAGPARARAYIDRLLHLWGRETPAKGS    281 - 350
EGEQGPLRHAASPSPQRQGGWSTDGGGRLLVFAPGREDEGGPAQSRGAGRGGPQQQGYMPLEGPQQSGSL    351 - 420
PEEGSKPSNSCVLRETMVQASPSSKAQQTPSAQDYGRGNIISPSRMLDKSPSPASGHFAHPSFAASLKMG    421 - 490
PPKSKAEKIKRSPMDKVLRFARQPLLLLDRPEGAHAAPQPSLEWDPAHWPTGRGGLQRRPALAWEAPGRS    491 - 560
CSESTLYPMPVLVPLAVAPQESHRTSAQALFPFEASLLTSVARRKHRRWQSTVEISARARLASCPESNLG    561 - 630
PPRPVARRAGGPLARGRPSLVRQDAYTRSDSEPSKHSAECDPRFPSVIPETSEGESSDHTTNRFGDRESS    631 - 700
SSDEEGGAQSRDCDLALGYVAAGHAELAWTQEAPVSSGPLLSPVPKLCRIKASKALKKKIRRFQPTALKV    701 - 770
MTMV                                                                      771 - 774
//

Text Mined References (19)

PMID Year Title
25524937 2015 Expression and epigenetic regulation of DACT1 and DACT2 in oral squamous cell carcinoma.
25521223 2015 Pilomyxoid Astrocytoma (PMA) Shows Significant Differences in Gene Expression vs. Pilocytic Astrocytoma (PA) and Variable Tendency Toward Maturation to PA.
25375359 2014 Methylation of DACT2 promotes papillary thyroid cancer metastasis by activating Wnt signaling.
25023701 2015 DACT2 is a functional tumor suppressor through inhibiting Wnt/?-catenin pathway and associated with poor survival in colon cancer.
23803417 2013 DACT2 is a candidate tumor suppressor and prognostic marker in esophageal squamous cell carcinoma.
23754948 2013 Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits.
23496880 2013 Reduced expression of DACT2 promotes hepatocellular carcinoma progression: involvement of methylation-mediated gene silencing.
23449122 2013 Epigenetic regulation of the Wnt signaling inhibitor DACT2 in human hepatocellular carcinoma.
23244112 2012 Relationships among MTHFR a1298c gene polymorphisms and methylation status of Dact1 gene in transitional cell carcinomas.
22806826 2013 Epigenetic regulation of DACT2, a key component of the Wnt signalling pathway in human lung cancer.
More...