Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.91
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
adult high grade glioma 3801 1.1e-04

Expression

  Differential Expression (1)

Disease log2 FC p
adult high grade glioma -1.100 1.1e-04

Gene RIF (1)

AA Sequence

MENFQYSVQLSDQDWAEFSATADECGLLQAGLASGDELLSSDIDQGDSSGSSPPRAPPLPTGQLAAGGRS      1 - 70
RRGCEEEDVATQQPVSRSQGEPVLALGTGQQTPSTSARAEAPPSLGPGASPPSQFSSCPGPASSGDQMQR     71 - 140
LLQGPAPRPPGEPPGSPKSPGHSTGSQRPPDSPGAPPRSPSRKKRRAVGAKGGGHTGASASAQTGSPLLP    141 - 210
AASPETAKLMAKAGQEELGPGPAGAPEPGPRSPVQEDRPGPGLGLSTPVPVTEQGTDQIRTPRRAKLHTV    211 - 280
STTVWEALPDVSRAKSDMAVSTPASEPQPDRDMAVSTPASEPQSDRDMAVSTPASEPQPDTDMAVSTPAS    281 - 350
EPQPDRDMAVSIPASKPQSDTAVSTPASEPQSSVALSTPISKPQLDTDVAVSTPASKHGLDVALPTAGPV    351 - 420
AKLEVASSPPVSEAVPRMTESSGLVSTPVPRADAAGLAWPPTRRAGPDVVEMEAVVSEPSAGAPGCCSGA    421 - 490
PALGLTQVPRKKKVRFSVAGPSPNKPGSGQASARPSAPQTATGAHGGPGAWEAVAVGPRPHQPRILKHLP    491 - 560
RPPPSAVTRVGPGSSFAVTLPEAYEFFFCDTIEENEEAEAAAAGQDPAGVQWPDMCEFFFPDVGAQRSRR    561 - 630
RGSPEPLPRADPVPAPIPGDPVPISIPEVYEHFFFGEDRLEGVLGPAVPLPLQALEPPRSASEGAGPGTP    631 - 700
LKPAVVERLHLALRRAGELRGPVPSFAFSQNDMCLVFVAFATWAVRTSDPHTPDAWKTALLANVGTISAI    701 - 770
RYFRRQVGQGRRSHSPSPSS                                                      771 - 790
//

Text Mined References (7)

PMID Year Title