Property Summary

NCBI Gene PubMed Count 4
Grant Count 1
R01 Count 1
Funding $108,000.25
PubMed Score 2.80
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
adult high grade glioma 2,148

Expression

  Differential Expression (1)

Disease log2 FC p
adult high grade glioma -1.100 0.000

Gene RIF (1)

PMID Text
24870542 Proteomics evidence was identified for the PERM1 gene

AA Sequence

MENFQYSVQLSDQDWAEFSATADECGLLQAGLASGDELLSSDIDQGDSSGSSPPRAPPLPTGQLAAGGRS      1 - 70
RRGCEEEDVATQQPVSRSQGEPVLALGTGQQTPSTSARAEAPPSLGPGASPPSQFSSCPGPASSGDQMQR     71 - 140
LLQGPAPRPPGEPPGSPKSPGHSTGSQRPPDSPGAPPRSPSRKKRRAVGAKGGGHTGASASAQTGSPLLP    141 - 210
AASPETAKLMAKAGQEELGPGPAGAPEPGPRSPVQEDRPGPGLGLSTPVPVTEQGTDQIRTPRRAKLHTV    211 - 280
STTVWEALPDVSRAKSDMAVSTPASEPQPDRDMAVSTPASEPQSDRDMAVSTPASEPQPDTDMAVSTPAS    281 - 350
EPQPDRDMAVSIPASKPQSDTAVSTPASEPQSSVALSTPISKPQLDTDVAVSTPASKHGLDVALPTAGPV    351 - 420
AKLEVASSPPVSEAVPRMTESSGLVSTPVPRADAAGLAWPPTRRAGPDVVEMEAVVSEPSAGAPGCCSGA    421 - 490
PALGLTQVPRKKKVRFSVAGPSPNKPGSGQASARPSAPQTATGAHGGPGAWEAVAVGPRPHQPRILKHLP    491 - 560
RPPPSAVTRVGPGSSFAVTLPEAYEFFFCDTIEENEEAEAAAAGQDPAGVQWPDMCEFFFPDVGAQRSRR    561 - 630
RGSPEPLPRADPVPAPIPGDPVPISIPEVYEHFFFGEDRLEGVLGPAVPLPLQALEPPRSASEGAGPGTP    631 - 700
LKPAVVERLHLALRRAGELRGPVPSFAFSQNDMCLVFVAFATWAVRTSDPHTPDAWKTALLANVGTISAI    701 - 770
RYFRRQVGQGRRSHSPSPSS                                                      771 - 790
//

Text Mined References (7)

PMID Year Title
24870542 2014 A draft map of the human proteome.
23836911 2013 Peroxisome proliferator-activated receptor ? coactivator 1 (PGC-1)- and estrogen-related receptor (ERR)-induced regulator in muscle 1 (Perm1) is a tissue-specific regulator of oxidative capacity in skeletal muscle cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8681137 1996 Identification of 4370 expressed sequence tags from a 3'-end-specific cDNA library of human skeletal muscle by DNA sequencing and filter hybridization.