Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.45
PubTator Score 6.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 2.4e-18

Gene RIF (3)

AA Sequence

MSMSANTMIFMILGASVVMAIACLMDMNALLDRFHNYILPHLRGEDRVCHCNCGRHHIHYVIPYDGDQSV      1 - 70
VDASENYFVTDSVTKQEIDLMLGLLLGFCISWFLVWMDGVLHCAVRAWRAGRRYDGSWTWLPKLCSLREL     71 - 140
GRRPHRPFEEAAGNMVHVKQKLYHNGHPSPRHL                                         141 - 173
//

Text Mined References (8)

PMID Year Title