Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.11
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Gene RIF (1)

PMID Text
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSQGSGGVPLVQAPYTVLLLPLGTSRQDPGAQSFFLWLRRMQALEREQDALWQGLELLQHGQAWFEDHL      1 - 70
REAQRQQLHLGALGENFLTDLHSEPGRPPLAQIQKVNICLQNLIHEKELSRQQKGVTQPKEEMAQRGCTK     71 - 140
GPRGPTRV                                                                  141 - 148
//

Text Mined References (7)

PMID Year Title
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8812450 1996 Localization of eight additional genes in the human major histocompatibility complex, including the gene encoding the casein kinase II beta subunit (CSNK2B).
2477242 1989 Identification of multiple HTF-island associated genes in the human major histocompatibility complex class III region.