Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.11
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 4.3e-09

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 4.3e-09

Synonym

Accession Q5SSQ6 A2ABF2 A2ABS9 Q9Y335
Symbols NG23
C6orf26

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (1)

AA Sequence

MGSQGSGGVPLVQAPYTVLLLPLGTSRQDPGAQSFFLWLRRMQALEREQDALWQGLELLQHGQAWFEDHL      1 - 70
REAQRQQLHLGALGENFLTDLHSEPGRPPLAQIQKVNICLQNLIHEKELSRQQKGVTQPKEEMAQRGCTK     71 - 140
GPRGPTRV                                                                  141 - 148
//

Text Mined References (7)

PMID Year Title