Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.91
PubTator Score 8.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 9.5e-05
glioblastoma 1.100 6.4e-03
group 4 medulloblastoma 1.300 1.5e-03
medulloblastoma, large-cell 1.500 8.3e-05
non primary Sjogren syndrome sicca 1.100 1.6e-02
osteosarcoma 1.204 6.1e-04
ovarian cancer -1.800 3.2e-09
pancreatic cancer 1.300 8.5e-03

Gene RIF (11)

AA Sequence

MATDTSQGELVHPKALPLIVGAQLIHADKLGEKVEDSTMPIRRTVNSTRETPPKSKLAEGEEEKPEPDIS      1 - 70
SEESVSTVEEQENETPPATSSEAEQPKGEPENEEKEENKSSEETKKDEKDQSKEKEKKVKKTIPSWATLS     71 - 140
ASQLARAQKQTPMASSPRPKMDAILTEAIKACFQKSGASVVAIRKYIIHKYPSLELERRGYLLKQALKRE    141 - 210
LNRGVIKQVKGKGASGSFVVVQKSRKTPQKSRNRKNRSSAVDPEPQVKLEDVLPLAFTRLCEPKEASYSL    211 - 280
IRKYVSQYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAI    281 - 350
AAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWMEQISGKGFSGTFQLCFPYYPSPG    351 - 420
VLFPKKEPDDSRDEDEDEDESSEEDSEDEEPPPKRRLQKKTPAKSPGKAASVKQRGSKPAPKVSAAQRGK    421 - 490
ARPLPKKAPPKAKTPAKKTRPSSTVIKKPSGGSSKKPATSARKEVKLPGKGKSTMKKSFRVKK           491 - 553
//

Text Mined References (29)

PMID Year Title