Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.86
PubTator Score 8.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.204 0.001
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.100 0.006
group 4 medulloblastoma 1.300 0.001
medulloblastoma, large-cell 1.500 0.000
non primary Sjogren syndrome sicca 1.100 0.016
ovarian cancer 1.900 0.000
pancreatic cancer 1.300 0.008

Synonym

Accession Q5SSJ5 A6NI71 A8K5D7 B3KMZ8 B4E210 Q05BI0 Q5SSJ6 Q5SWC6 Q6PIM9 Q8NDF0 Q9UHY0
Symbols HP1BP74
HP1-BP74

Gene

PDB

2RQP  

Gene RIF (8)

PMID Text
26402843 HP1BP3 regulates hepatic expression of IGF1 and its binding proteins in mice, thus modulating the endocrine IGF1 pathway.
25662603 HP1BP3 is a component of heterochromatin, and its recruitment is dependent on a functional interaction with HP1 proteins.
25100860 Quantitative profiling of chromatome dynamics reveals an important role for HP1BP3 in hypoxia-induced oncogenesis.
24317310 found two biomarker loci at HP1BP3 and TTC9B, which predicted postpartum depression
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20042602 HP1-BP74 directly binds to HP1, and its middle region associates with linker DNA at the entry/exit site of nucleosomal DNA in vitro
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.

AA Sequence

MATDTSQGELVHPKALPLIVGAQLIHADKLGEKVEDSTMPIRRTVNSTRETPPKSKLAEGEEEKPEPDIS      1 - 70
SEESVSTVEEQENETPPATSSEAEQPKGEPENEEKEENKSSEETKKDEKDQSKEKEKKVKKTIPSWATLS     71 - 140
ASQLARAQKQTPMASSPRPKMDAILTEAIKACFQKSGASVVAIRKYIIHKYPSLELERRGYLLKQALKRE    141 - 210
LNRGVIKQVKGKGASGSFVVVQKSRKTPQKSRNRKNRSSAVDPEPQVKLEDVLPLAFTRLCEPKEASYSL    211 - 280
IRKYVSQYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAI    281 - 350
AAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWMEQISGKGFSGTFQLCFPYYPSPG    351 - 420
VLFPKKEPDDSRDEDEDEDESSEEDSEDEEPPPKRRLQKKTPAKSPGKAASVKQRGSKPAPKVSAAQRGK    421 - 490
ARPLPKKAPPKAKTPAKKTRPSSTVIKKPSGGSSKKPATSARKEVKLPGKGKSTMKKSFRVKK           491 - 553
//

Text Mined References (26)

PMID Year Title
26402843 2015 Proportionate Dwarfism in Mice Lacking Heterochromatin Protein 1 Binding Protein 3 (HP1BP3) Is Associated With Alterations in the Endocrine IGF-1 Pathway.
25662603 2015 HP1BP3 is a novel histone H1 related protein with essential roles in viability and growth.
25416956 2014 A proteome-scale map of the human interactome network.
25100860 2014 Quantitative profiling of chromatome dynamics reveals a novel role for HP1BP3 in hypoxia-induced oncogenesis.
24830416 2014 Profiling of the Chromatin-associated Proteome Identifies HP1BP3 as a Novel Regulator of Cell Cycle Progression.
24317310 2014 Seeing the future: epigenetic biomarkers of postpartum depression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...