Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.31
PubTator Score 1.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.0e-08

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.425 3.0e-08

Synonym

Accession Q5SRR4 A6NCW4 B0UXB3 B0UXB4 B0UZ69 B0UZQ0 B1B0L9 O95871 Q5SQ59 Q8NDY0 Q8NDY1
Symbols G5C
NG33
C6orf20
LY6G5CA
LY6G5CB

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MRFMAGPAGSQSLGPLCFHSSPQALYTVLLIVLVMMSLVFGKFVPVNWEPPQPLPFPKYLRCYRCLLETK      1 - 70
ELGCLLGSDICLTPAGSSCITLHKKNSSGSDVMVSDCRSKEQMSDCSNTRTSPVSGFWIFSQYCFLDFCN     71 - 140
DPQNRGLYTP                                                                141 - 150
//

Text Mined References (7)

PMID Year Title