Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.14
PubTator Score 1.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Liver neoplasms 109
Disease Target Count P-value
psoriasis 6685 4.62103997646197E-55
lung carcinoma 2844 1.71209319062577E-28
ovarian cancer 8492 3.64361507196205E-6
atypical teratoid / rhabdoid tumor 4369 7.61184986221585E-5
breast carcinoma 1614 1.00040778992925E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.16209016533781E-4
glioblastoma 5572 3.17375240717675E-4
interstitial cystitis 2299 5.6535755959025E-4
Atopic dermatitis 944 5.91107207328377E-4
lung cancer 4473 7.2811418144199E-4
fibroadenoma 557 9.71810348724912E-4
medulloblastoma, large-cell 6234 0.00130987566863003
sonic hedgehog group medulloblastoma 1482 0.00187747915862386
adult high grade glioma 2148 0.00200997519232182
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00204320871271434
ductal carcinoma in situ 1745 0.0024035040426268
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00292167757395947
osteosarcoma 7933 0.00329621923147576
subependymal giant cell astrocytoma 2287 0.0189188849644348
invasive ductal carcinoma 2950 0.02088319447587

Expression

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG Inparanoid

 Compartment GO Term (1)

AA Sequence

MGQKGHKDSLYPCGGTPESSLHEALDQCMTALDLFLTNQFSEALSYLKPRTKESMYHSLTYATILEMQAM      1 - 70
MTFDPQDILLAGNMMKEAQMLCQRHRRKSSVTDSFSSLVNRPTLGQFTEEEIHAEVCYAECLLQRAALTF     71 - 140
LQGSSHGGAVRPRALHDPSHACSCPPGPGRQHLFLLQDENMVSFIKGGIKVRNSYQTYKELDSLVQSSQY    141 - 210
CKGENHPHFEGGVKLGVGAFNLTLSMLPTRILRLLEFVGFSGNKDYGLLQLEEGASGHSFRSVLCVMLLL    211 - 280
CYHTFLTFVLGTGNVNIEEAEKLLKPYLNRYPKGAIFLFFAGRIEVIKGNIDAAIRRFEECCEAQQHWKQ    281 - 350
FHHMCYWELMWCFTYKGQWKMSYFYADLLSKENCWSKATYIYMKAAYLSMFGKEDHKPFGDDEVELFRAV    351 - 420
PGLKLKIAGKSLPTEKFAIRKSRRYFSSNPISLPVPALEMMYIWNGYAVIGKQPKLTDGILEIITKAEEM    421 - 490
LEKGPENEYSVDDECLVKLLKGLCLKYLGRVQEAEENFRSISANEKKIKYDHYLIPNALLELALLLMEQD    491 - 560
RNEEAIKLLESAKQNYKNYSMESRTHFRIQAATLQAKSSLENSSRSMVSSVSL                     561 - 613
//

Text Mined References (6)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9461476 1998 Differential screening and suppression subtractive hybridization identified genes differentially expressed in an estrogen receptor-positive breast carcinoma cell line.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.