Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.14
PubTator Score 1.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.300 2.0e-03
Atopic dermatitis 1.300 5.9e-04
atypical teratoid / rhabdoid tumor -1.100 7.6e-05
breast carcinoma 1.900 1.0e-04
ductal carcinoma in situ 2.300 2.4e-03
fibroadenoma 1.700 9.7e-04
glioblastoma -1.100 3.2e-04
interstitial cystitis -1.700 5.7e-04
intraductal papillary-mucinous adenoma (... 1.900 3.2e-04
intraductal papillary-mucinous carcinoma... 2.000 2.0e-03
intraductal papillary-mucinous neoplasm ... 2.000 2.9e-03
invasive ductal carcinoma 2.600 2.1e-02
lung cancer -1.200 4.9e-03
lung carcinoma 1.800 1.7e-28
medulloblastoma -1.100 2.8e-04
medulloblastoma, large-cell -1.100 1.3e-03
osteosarcoma -1.355 3.3e-03
ovarian cancer 1.700 3.6e-06
psoriasis 2.300 6.4e-13
subependymal giant cell astrocytoma 2.782 1.9e-02

 Compartment GO Term (1)

AA Sequence

MGQKGHKDSLYPCGGTPESSLHEALDQCMTALDLFLTNQFSEALSYLKPRTKESMYHSLTYATILEMQAM      1 - 70
MTFDPQDILLAGNMMKEAQMLCQRHRRKSSVTDSFSSLVNRPTLGQFTEEEIHAEVCYAECLLQRAALTF     71 - 140
LQGSSHGGAVRPRALHDPSHACSCPPGPGRQHLFLLQDENMVSFIKGGIKVRNSYQTYKELDSLVQSSQY    141 - 210
CKGENHPHFEGGVKLGVGAFNLTLSMLPTRILRLLEFVGFSGNKDYGLLQLEEGASGHSFRSVLCVMLLL    211 - 280
CYHTFLTFVLGTGNVNIEEAEKLLKPYLNRYPKGAIFLFFAGRIEVIKGNIDAAIRRFEECCEAQQHWKQ    281 - 350
FHHMCYWELMWCFTYKGQWKMSYFYADLLSKENCWSKATYIYMKAAYLSMFGKEDHKPFGDDEVELFRAV    351 - 420
PGLKLKIAGKSLPTEKFAIRKSRRYFSSNPISLPVPALEMMYIWNGYAVIGKQPKLTDGILEIITKAEEM    421 - 490
LEKGPENEYSVDDECLVKLLKGLCLKYLGRVQEAEENFRSISANEKKIKYDHYLIPNALLELALLLMEQD    491 - 560
RNEEAIKLLESAKQNYKNYSMESRTHFRIQAATLQAKSSLENSSRSMVSSVSL                     561 - 613
//

Text Mined References (6)

PMID Year Title