Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
interstitial lung disease 1.200 0.006
astrocytic glioma 1.300 0.014
ependymoma 1.600 0.018
oligodendroglioma 1.700 0.007
osteosarcoma 2.867 0.000
intraductal papillary-mucinous adenoma (... 1.600 0.000
intraductal papillary-mucinous carcinoma... 1.600 0.000
Alzheimer's disease -1.200 0.029
Pick disease -1.400 0.000
progressive supranuclear palsy -1.200 0.013
ovarian cancer 1.400 0.000

Synonym

Accession Q5SRD1 Q5SRD2
Symbols bA592B15.7

Gene

PANTHER Protein Class (2)

AA Sequence

MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTR      1 - 70
GRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSA     71 - 140
FGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTETGFHHGAQANFQSEIIFRFLTRFFYAKKKASYSQISQK    141 - 210
NLDFTILLRLKTLRSVESKCYVIFVVDELLKNRIPQRIKCLMHNKPT                           211 - 257
//

Text Mined References (10)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15044455 2004 Tim50, a component of the mitochondrial translocator, regulates mitochondrial integrity and cell death.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12437925 2002 Tim50 is a subunit of the TIM23 complex that links protein translocation across the outer and inner mitochondrial membranes.
10393182 1999 The TIM17.23 preprotein translocase of mitochondria: composition and function in protein transport into the matrix.
10339406 1999 Genetic and structural characterization of the human mitochondrial inner membrane translocase.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.