Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.37
PubTator Score 0.39

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLQQILHDMYIDPELLAELSDVQKHILFYKMREEQLRRWKERETWEALAQDEGLRPPKTKRASDKHIQWL      1 - 70
LGADGEVWVWIMGEGPGDKPYEEISEELIAERARLQAQREAEELWRQKEAEITKKFRDALANEKARILAE     71 - 140
KWKVEMEDRKAAKVLEERIHEEFKRKEEEERKRGEEQIRLQEEQRAKELYWTLKQAQLHCQASEKEEREW    141 - 210
EEQLRRSKAADEERSRRAQRARDEYRHHSLRAIQKGTVAGLSSMFRELGQSHEQEARLYHHLPDPGLPQP    211 - 280
LALPVRTWERPLRPVSRDVIVRWFKEEQLPRRAGFERNTKFIAPWFHGIISREDAEALLENMTEGAFLVR    281 - 350
VSEKIWGYTLSYRLQKGFKHFLVDASGDFYSFLGVDPNRHATLTDLVDFHKEEIITVSGGELLQEPCGQR    351 - 420
DSPPDYHLLFE                                                               421 - 431
//

Text Mined References (4)

PMID Year Title
22864933 2012 Identification of novel germline polymorphisms governing capecitabine sensitivity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.