Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.37
PubTator Score 0.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Disease of anatomical entity 32 0.0 1.9
Disease Target Count Z-score Confidence
Arrhythmogenic right ventricular cardiomyopathy 30 3.844 1.9

Expression

Gene RIF (1)

AA Sequence

MLQQILHDMYIDPELLAELSDVQKHILFYKMREEQLRRWKERETWEALAQDEGLRPPKTKRASDKHIQWL      1 - 70
LGADGEVWVWIMGEGPGDKPYEEISEELIAERARLQAQREAEELWRQKEAEITKKFRDALANEKARILAE     71 - 140
KWKVEMEDRKAAKVLEERIHEEFKRKEEEERKRGEEQIRLQEEQRAKELYWTLKQAQLHCQASEKEEREW    141 - 210
EEQLRRSKAADEERSRRAQRARDEYRHHSLRAIQKGTVAGLSSMFRELGQSHEQEARLYHHLPDPGLPQP    211 - 280
LALPVRTWERPLRPVSRDVIVRWFKEEQLPRRAGFERNTKFIAPWFHGIISREDAEALLENMTEGAFLVR    281 - 350
VSEKIWGYTLSYRLQKGFKHFLVDASGDFYSFLGVDPNRHATLTDLVDFHKEEIITVSGGELLQEPCGQR    351 - 420
DSPPDYHLLFE                                                               421 - 431
//

Text Mined References (4)

PMID Year Title