Property Summary

NCBI Gene PubMed Count 24
PubMed Score 72.25
PubTator Score 17.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.200 3.0e-02
atypical teratoid / rhabdoid tumor 1.500 3.8e-07
group 3 medulloblastoma 1.400 4.9e-04
lung cancer 2.100 1.3e-04
medulloblastoma, large-cell 1.500 2.2e-04
osteosarcoma -1.172 6.2e-04
primitive neuroectodermal tumor 1.300 1.6e-03

Protein-protein Interaction (2)

Gene RIF (12)

AA Sequence

MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDELGKASAKAQNLSAPITSASRM      1 - 70
QSNRHVVYILKDSSARPAGKGAIIGFIKVGYKKLFVLDDREAHNEVEPLCILDFYIHESVQRHGHGRELF     71 - 140
QYMLQKERVEPHQLAIDRPSQKLLKFLNKHYNLETTVPQVNNFVIFEGFFAHQHRPPAPSLRATRHSRAA    141 - 210
AVDPTPAAPARKLPPKRAEGDIKPYSSSDREFLKVAVEPPWPLNRAPRRATPPAHPPPRSSSLGNSPERG    211 - 280
PLRPFVPEQELLRSLRLCPPHPTARLLLAADPGGSPAQRRRTRGTPPGLVAQSCCYSRHGGVNSSSPNTG    281 - 350
NQDSKQGEQETKNRSASEEQALSQDGSGEKPMHTAPPQAPAPPAQSWTVGGDILNARFIRNLQERRSTRP    351 - 420
W//

Text Mined References (30)

PMID Year Title