Property Summary

NCBI Gene PubMed Count 21
Grant Count 24
R01 Count 9
Funding $7,268,684.32
PubMed Score 66.96
PubTator Score 17.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.200 0.030
osteosarcoma -1.172 0.001
medulloblastoma 1.800 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
medulloblastoma, large-cell 1.500 0.000
primitive neuroectodermal tumor 1.500 0.000
lung cancer 2.100 0.000

Gene RIF (9)

PMID Text
26227334 Studies indicate that alpha-tubulin acetylation and microtubule level is mainly governed by opposing actions of alpha-tubulin acetyltransferase 1 (ATAT1) and histone deacetylase 6 (HDAC6).
25602620 Data suggest that invariant residues Arg132 and Ser160 in catalytic domain of ATAT1 participate in stable interaction with CoA and acetyl-CoA; ATAT1 with mutation at either residue exhibits much faster intracellular degradation.
24906155 Mechanistic underpinnings for TAT activity and its preference for microtubules with slow turnover; cocrystal structures constrain TAT action to the microtubule lumen with Lys40 engaged in a suboptimal active site; despite the confined location of Lys40, TAT efficiently scans the microtubule bidirectionally and acetylates stochastically without preference for ends.
24846647 Crystal structure of the catalytic core of human MEC-17 in complex with acetyl-CoA. MEC17 has large, conserved surface patch that is critical for enzymatic activity suggesting extensive interactions with alpha-tubulin.
24760594 Results suggest that lithium chloride (LiCl) treatments activate alpha-tubulin N-acetyltransferase 1 (alphaTAT1) by the inhibition of glycogen synthase kinase 3 beta (GSK-3beta) and promote the alpha-tubulin acetylation, and then elongate the primary cilia.
24097348 microtubules contacting clathrin-coated pits become acetylated by alphaTAT1; in migrating cells, this mechanism ensures the acetylation of microtubules oriented towards the leading edge, thus promoting directional cell locomotion and chemotaxis
23071318 analysis reveals a basic patch implicated in substrate binding and a conserved glutamine residue required for catalysis, demonstrating that the family of alpha-tubulin acetyltransferases uses a reaction mechanism different from other lysine acetyltransferases
23071314 cysteine residues play important catalytic roles through a ternary complex mechanism. alphaTAT1 mutations have analogous effects on tubulin acetylation in vitro and in cells
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDELGKASAKAQNLSAPITSASRM      1 - 70
QSNRHVVYILKDSSARPAGKGAIIGFIKVGYKKLFVLDDREAHNEVEPLCILDFYIHESVQRHGHGRELF     71 - 140
QYMLQKERVEPHQLAIDRPSQKLLKFLNKHYNLETTVPQVNNFVIFEGFFAHQHRPPAPSLRATRHSRAA    141 - 210
AVDPTPAAPARKLPPKRAEGDIKPYSSSDREFLKVAVEPPWPLNRAPRRATPPAHPPPRSSSLGNSPERG    211 - 280
PLRPFVPEQELLRSLRLCPPHPTARLLLAADPGGSPAQRRRTRGTPPGLVAQSCCYSRHGGVNSSSPNTG    281 - 350
NQDSKQGEQETKNRSASEEQALSQDGSGEKPMHTAPPQAPAPPAQSWTVGGDILNARFIRNLQERRSTRP    351 - 420
W//

Text Mined References (27)

PMID Year Title
26227334 2015 Tubulin acetylation: responsible enzymes, biological functions and human diseases.
25602620 2015 Structural basis of cofactor-mediated stabilization and substrate recognition of the ?-tubulin acetyltransferase ?TAT1.
24906155 2014 Molecular basis for age-dependent microtubule acetylation by tubulin acetyltransferase.
24846647 2014 Structural and functional characterization of the ?-tubulin acetyltransferase MEC-17.
24760594 2015 The elongation of primary cilia via the acetylation of ?-tubulin by the treatment with lithium chloride in human fibroblast KD cells.
24619423 2014 Reactive oxygen species, AMP-activated protein kinase, and the transcription cofactor p300 regulate ?-tubulin acetyltransferase-1 (?TAT-1/MEC-17)-dependent microtubule hyperacetylation during cell stress.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24097348 2013 ?TAT1 catalyses microtubule acetylation at clathrin-coated pits.
23720746 2013 Mice lacking ?-tubulin acetyltransferase 1 are viable but display ?-tubulin acetylation deficiency and dentate gyrus distortion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...