Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.19
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession Q5SQH8 A9R9P9 F8VX15 Q5SU01 Q6ZSB7 Q8TB84
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
22461910 C6orf136 was found to be differentially methylated and differentially expressed in human squamous cell carcinomas

AA Sequence

MYQPSRGAARRLGPCLRAYQARPQDQLYPGTLPFPPLWPHSTTTTSPSSPLFWSPLPPRLPTQRLPQVPP      1 - 70
LPLPQIQALSSAWVVLPPGKGEEGPGPELHSGCLDGLRSLFEGPPCPYPGAWIPFQVPGTAHPSPATPSG     71 - 140
DPSMEEHLSVMYERLRQELPKLFLQSHDYSLYSLDVEFINEILNIRTKGRTWYILSLTLCRFLAWNYFAH    141 - 210
LRLEVLQLTRHPENWTLQARWRLVGLPVHLLFLRFYKRDKDEHYRTYDAYSTFYLNSSGLICRHRLDKLM    211 - 280
PSHSPPTPVKKLLVGALVALGLSEPEPDLNLCSKP                                       281 - 315
//

Text Mined References (9)

PMID Year Title
22461910 2012 FOXM1 induces a global methylation signature that mimics the cancer epigenome in head and neck squamous cell carcinoma.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.