Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.62
PubTator Score 1.93

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (3)

AA Sequence

MAVLFLLLFLCGTPQAADNMQAIYVALGEAVELPCPSPPTLHGDEHLSWFCSPAAGSFTTLVAQVQVGRP      1 - 70
APDPGKPGRESRLRLLGNYSLWLEGSKEEDAGRYWCAVLGQHHNYQNWRVYDVLVLKGSQLSARAADGSP     71 - 140
CNVLLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPRSRRPRIIRCLMTHNKGV    141 - 210
SFSLAASIDASPALCAPSTGWDMPWILMLLLTMGQGVVILALSIVLWRQRVRGAPGRDASIPQFKPEIQV    211 - 280
YENIHLARLGPPAHKPR                                                         281 - 297
//

Text Mined References (9)

PMID Year Title