Property Summary

NCBI Gene PubMed Count 5
Grant Count 114
R01 Count 32
Funding $13,536,271.27
PubMed Score 113.75
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.808 0.000
medulloblastoma, large-cell 1.400 0.000

Synonym

Accession Q5SNT2 B9EH90 Q5SNT3
Symbols Ima1
NET5
SAMP1

Gene

Gene RIF (2)

PMID Text
24950247 the nucleoplasmic domains of Samp1 and Emerin can bind directly to each other.
19494128 characterization of a transmembrane protein of the nuclear envelope that we name spindle-associated membrane protein 1 (Samp1); Samp1 defines a specific membrane domain associated with the mitotic spindle

AA Sequence

MEGVSALLARCPTAGLAGGLGVTACAAAGVLLYRIARRMKPTHTMVNCWFCNQDTLVPYGNRNCWDCPHC      1 - 70
EQYNGFQENGDYNKPIPAQYLEHLNHVVSSAPSLRDPSQPQQWVSSQVLLCKRCNHHQTTKIKQLAAFAP     71 - 140
REEGRYDEEVEVYRHHLEQMYKLCRPCQAAVEYYIKHQNRQLRALLLSHQFKRREADQTHAQNFSSAVKS    141 - 210
PVQVILLRALAFLACAFLLTTALYGASGHFAPGTTVPLALPPGGNGSATPDNGTTPGAEGWRQLLGLLPE    211 - 280
HMAEKLCEAWAFGQSHQTGVVALGLLTCLLAMLLAGRIRLRRIDAFCTCLWALLLGLHLAEQHLQAASPS    281 - 350
WLDTLKFSTTSLCCLVGFTAAVATRKATGPRRFRPRRFFPGDSAGLFPTSPSLAIPHPSVGGSPASLFIP    351 - 420
SPPSFLPLANQQLFRSPRRTSPSSLPGRLSRALSLGTIPSLTRADSGYLFSGSRPPSQVSRSGEFPVSDY    421 - 490
FSLLSGSCPSSPLPSPAPSVAGSVASSSGSLRHRRPLISPARLNLKGQKLLLFPSPPGEAPTTPSSSDEH    491 - 560
SPHNGSLFTMEPPHVPRKPPLQDVKHALDLRSKLERGSACSNRSIKKEDDSSQSSTCVVDTTTRGCSEEA    561 - 630
ATWRGRFGPSLVRGLLAVSLAANALFTSVFLYQSLR                                      631 - 666
//

Text Mined References (12)

PMID Year Title
24950247 2014 MCLIP, an effective method to detect interactions of transmembrane proteins of the nuclear envelope in live cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21327071 A transmembrane inner nuclear membrane protein in the mitotic spindle.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19494128 2009 An integral protein of the inner nuclear membrane localizes to the mitotic spindle in mammalian cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...