Property Summary

NCBI Gene PubMed Count 5
PubMed Score 119.82
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.2e-10
medulloblastoma, large-cell 6241 1.6e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Crohn's disease 321 5.558 2.8
Colitis 54 3.854 1.9
Amyloidosis 67 3.592 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.400 1.6e-06
osteosarcoma -2.808 1.2e-10

Gene RIF (2)

AA Sequence

MEGVSALLARCPTAGLAGGLGVTACAAAGVLLYRIARRMKPTHTMVNCWFCNQDTLVPYGNRNCWDCPHC      1 - 70
EQYNGFQENGDYNKPIPAQYLEHLNHVVSSAPSLRDPSQPQQWVSSQVLLCKRCNHHQTTKIKQLAAFAP     71 - 140
REEGRYDEEVEVYRHHLEQMYKLCRPCQAAVEYYIKHQNRQLRALLLSHQFKRREADQTHAQNFSSAVKS    141 - 210
PVQVILLRALAFLACAFLLTTALYGASGHFAPGTTVPLALPPGGNGSATPDNGTTPGAEGWRQLLGLLPE    211 - 280
HMAEKLCEAWAFGQSHQTGVVALGLLTCLLAMLLAGRIRLRRIDAFCTCLWALLLGLHLAEQHLQAASPS    281 - 350
WLDTLKFSTTSLCCLVGFTAAVATRKATGPRRFRPRRFFPGDSAGLFPTSPSLAIPHPSVGGSPASLFIP    351 - 420
SPPSFLPLANQQLFRSPRRTSPSSLPGRLSRALSLGTIPSLTRADSGYLFSGSRPPSQVSRSGEFPVSDY    421 - 490
FSLLSGSCPSSPLPSPAPSVAGSVASSSGSLRHRRPLISPARLNLKGQKLLLFPSPPGEAPTTPSSSDEH    491 - 560
SPHNGSLFTMEPPHVPRKPPLQDVKHALDLRSKLERGSACSNRSIKKEDDSSQSSTCVVDTTTRGCSEEA    561 - 630
ATWRGRFGPSLVRGLLAVSLAANALFTSVFLYQSLR                                      631 - 666
//

Text Mined References (14)

PMID Year Title