Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.66
PubTator Score 7.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Obesity 616
Disease Target Count P-value
lung carcinoma 2844 1.55232174842358E-38
periodontitis 269 1.48952975974811E-20
Breast cancer 3099 4.51545983880866E-8
ependymoma 2514 9.92556327070363E-8
tuberculosis and treatment for 3 months 327 1.85448568283964E-6
pilocytic astrocytoma 3086 2.95089767797614E-6
medulloblastoma, large-cell 6234 3.33355420668956E-6
pediatric high grade glioma 2712 3.30987438525265E-5
glioblastoma 5572 2.10339025921215E-4
medulloblastoma 1524 2.23573372256509E-4
atypical teratoid / rhabdoid tumor 4369 2.71204669709199E-4
Amyotrophic Lateral Sclerosis 432 3.03631627341323E-4
cystic fibrosis 1670 5.2944497968409E-4
acute quadriplegic myopathy 1157 0.00107252664630259
primitive neuroectodermal tumor 3031 0.00164388048368567
fascioscapulohumeral muscular dystrophy 100 0.00263283389741764
invasive ductal carcinoma 2950 0.00275547043571553
ovarian cancer 8492 0.0038966469444551
diabetes mellitus 1663 0.00540085065499024
Pick disease 1893 0.00799521160505836
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00858437866709165
interstitial cystitis 2299 0.0101294394098991
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0114890532074433
osteosarcoma 7933 0.0190668180783641
ductal carcinoma in situ 1745 0.0331166138721571
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0359307907279162
progressive supranuclear palsy 674 0.0464314850099947
spina bifida 1064 0.049706007935829

Expression

Synonym

Accession Q5SGD2 Q2M3J2 Q96NM7
Symbols PP2CE
PPM1-LIKE
PP2C-epsilon

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (6)

PMID Text
22796112 identified ACBD3 as an interacting partner of PPM1L, and showed that this association, which recruits PPM1L to ER-Golgi membrane contact sites, is mediated by a GOLD (Golgi dynamics) domain in ACBD3
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19847890 Genetic variation at chromosome 3 harbors an element that regulates expression of an upstream candidate tumor suppressor, PPM1L, thus providing a novel mechanism for colorectal tumorigenesis.
18165232 CERT is a physiological substrate of PP2Cepsilon and that dephosphorylation of CERT by PP2Cepsilon may play an important role in the regulation of ceramide trafficking from the ER to the Golgi apparatus.
17456047 These results suggest that PP2Cepsilon maintains ASK1 in an inactive state by dephosphorylation in quiescent cells, supporting the possibility that PP2Cepsilon and PP5 play different roles in H2O2-induced regulation of ASK1 activity.
15560375 cloning and characterization of a novel human protein phosphatase 2C cDNA (PP2C epsilon*)

AA Sequence

MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQND      1 - 70
RLGGLDVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVK     71 - 140
SRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANV    141 - 210
GDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIP    211 - 280
DPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVK    281 - 350
FRNSSKTEEQ                                                                351 - 360
//

Text Mined References (16)

PMID Year Title
25676576 2015 Adiposity Alters Genes Important in Inflammation and Cell Cycle Division in Human Cumulus Granulosa Cell.
24583629 2014 Genome-wide analysis of methotrexate pharmacogenomics in rheumatoid arthritis shows multiple novel risk variants and leads for TYMS regulation.
24327956 2013 PPM1l encodes an inositol requiring-protein 1 (IRE1) specific phosphatase that regulates the functional outcome of the ER stress response.
24219008 2013 Dynamically regulated miRNA-mRNA networks revealed by exercise.
22796112 2012 Acyl-CoA binding domain containing 3 (ACBD3) recruits the protein phosphatase PPM1L to ER-Golgi membrane contact sites.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19847890 2010 Genome-wide scan identifies a copy number variable region at 3q26 that regulates PPM1L in APC mutation-negative familial colorectal cancer patients.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18165232 2008 Protein phosphatase 2Cepsilon is an endoplasmic reticulum integral membrane protein that dephosphorylates the ceramide transport protein CERT to enhance its association with organelle membranes.
17456047 2007 Regulation of apoptosis signal-regulating kinase 1 by protein phosphatase 2Cepsilon.
More...