Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.69
PubTator Score 7.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
acute quadriplegic myopathy 1.651 1.1e-03
adult high grade glioma -2.400 7.8e-06
Amyotrophic lateral sclerosis 1.313 3.0e-04
Astrocytoma, Pilocytic -1.700 4.6e-06
atypical teratoid / rhabdoid tumor -3.300 2.7e-04
Breast cancer -1.800 4.5e-08
cystic fibrosis -1.500 1.4e-03
diabetes mellitus -1.200 5.4e-03
ductal carcinoma in situ -1.200 3.3e-02
ependymoma -2.000 9.9e-08
fascioscapulohumeral muscular dystrophy 1.059 2.6e-03
glioblastoma -2.100 4.4e-07
interstitial cystitis -1.300 1.0e-02
intraductal papillary-mucinous adenoma (... 1.900 8.6e-03
intraductal papillary-mucinous carcinoma... 1.400 3.6e-02
intraductal papillary-mucinous neoplasm ... 2.400 1.1e-02
invasive ductal carcinoma -2.200 2.8e-03
lung carcinoma 2.500 1.6e-38
medulloblastoma -1.200 2.2e-04
medulloblastoma, large-cell -2.500 3.3e-06
osteosarcoma -1.033 1.9e-02
ovarian cancer -1.100 3.9e-03
periodontitis -1.200 1.5e-20
Pick disease -1.400 8.0e-03
primitive neuroectodermal tumor -1.500 1.6e-03
progressive supranuclear palsy -1.200 4.6e-02
spina bifida -1.139 5.0e-02
tuberculosis 2.400 2.0e-07

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQND      1 - 70
RLGGLDVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVK     71 - 140
SRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANV    141 - 210
GDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIP    211 - 280
DPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVK    281 - 350
FRNSSKTEEQ                                                                351 - 360
//

Text Mined References (16)

PMID Year Title