Property Summary

NCBI Gene PubMed Count 699
Grant Count 312
R01 Count 98
Funding $54,058,330.04
PubMed Score 1111.18
PubTator Score 1294.44

Knowledge Summary

Patent (36,126)

Expression

Synonym

Accession Q5S007 A6NJU2 Q6ZS50 Q8NCX9
Symbols PARK8
RIPK7
ROCO2
AURA17
DARDARIN

Gene

PDB

2ZEJ   3D6T  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (763)

PMID Text
27004687 This is the first study indicating that Sp1 signaling plays an important role in the regulation of human LRRK2 gene expression.
26930193 Data show that cyclin-dependent kinase 5 (Cdk5) could phosphorylate the adjacent S1627 in the leucine-rich repeat kinase 2 (LRRK2) R1628P mutant.
26865512 Elevated ratio of phosphorylated LRRK2 to total LRRK2 in urine predicted parkinsonian phenotypes in male LRRK2 carriers.
26844546 The results support a preferential association of LRRK2 variants with excessive pro-inflammatory responses in Leprosy.
26747879 none of the G2019S or R1441G/C/H mutations of LRRK2 were found in any of the 125 screened patients with Idiopathic REM Sleep Behavior disorder.
26651604 Induced pluripotent stem cells - derived sensory neurons with Parkinson's Disease-related LRRK2 G2019S mutation exhibited normal neurite length but had large microtubule-containing neurite aggregations.
26600626 The LRRK2 p.G2019S mutation is not an important causal factor of Parkinson Disease in Colombia having similar frequencies to those reported in other Latin American populations
26536050 Results indicate that non-manifesting carriers of the G2019S mutation in the leucine-rich repeat kinase 2 gene have a specific cognitive profile with executive functions
26519280 Fibroblasts isolated from skin biopsy specimens from patients with genetic forms of Parkinson's disease, carriers of mutations in LRRK2 and PARK2 genes, and from a healthy volunteer were reprogrammed into induced pluripotent stem cells.
26468079 This study demonstrated that The sleep phenotype in leucine-rich repeat kinase 2 mutations parallels that of idiopathic PD, except for absent rapid eye movement sleep behavior disorder here in the presymptomatic and symptomatic stages.
More...

AA Sequence

MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNIHVPLLIVLDS      1 - 70
YMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLD     71 - 140
LLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYMILLS    141 - 210
ALTNFKDEEEIVLHVLHCLHSLAIPCNNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLG    211 - 280
NFFNILVLNEVHEFVVKAVQQYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWL    281 - 350
EACYKALTWHRKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASAN    351 - 420
ALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIMAAVVPKILTV    421 - 490
MKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQ    491 - 560
KCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGTGHLLAKI    561 - 630
LVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFA    631 - 700
KVAMDDYLKNVMLERACDQNNSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQD    701 - 770
VRKALTISIGKGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLA    771 - 840
RMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFLVKKKSNS    841 - 910
ISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLRSSKLQSHMRHSDSISSLASE    911 - 980
REYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKSLTHLDLHSNKFTSF    981 - 1050
PSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKIS   1051 - 1120
GICSPLRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPE   1121 - 1190
AILNLPHLRSLDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEI   1191 - 1260
PPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQRLKKAV   1261 - 1330
PYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREE   1331 - 1400
FYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKIT   1401 - 1470
KELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKN   1471 - 1540
VPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQI   1541 - 1610
LTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVI   1611 - 1680
ELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLV   1681 - 1750
GSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGE   1751 - 1820
EHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGDGSF   1821 - 1890
GSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQ   1891 - 1960
QDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIK   1961 - 2030
TSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYG   2031 - 2100
CAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRNASIWLG   2101 - 2170
CGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEK   2171 - 2240
MTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSESTNST   2241 - 2310
ERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKT   2311 - 2380
EKLCGLIDCVHFLREVMVKENKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYN   2381 - 2450
FCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEK   2451 - 2520
MRRTSVE                                                                  2521 - 2527
//

Text Mined References (703)

PMID Year Title
27357661 2016 Structural model of the dimeric Parkinson's protein LRRK2 reveals a compact architecture involving distant interdomain contacts.
27314038 2016 G2385R and I2020T Mutations Increase LRRK2 GTPase Activity.
27013965 2016 Protective LRRK2 R1398H Variant Enhances GTPase and Wnt Signaling Activity.
27004687 2016 Regulation of LRRK2 promoter activity and gene expression by Sp1.
26930193 2016 Parkinson-Related LRRK2 Mutation R1628P Enables Cdk5 Phosphorylation of LRRK2 and Upregulates Its Kinase Activity.
26865512 2016 Urinary LRRK2 phosphorylation predicts parkinsonian phenotypes in G2019S LRRK2 carriers.
26844546 2016 A Missense LRRK2 Variant Is a Risk Factor for Excessive Inflammatory Responses in Leprosy.
26824392 2016 Phosphoproteomics reveals that Parkinson's disease kinase LRRK2 regulates a subset of Rab GTPases.
26747879 2016 Absence of LRRK2 mutations in a cohort of patients with idiopathic REM sleep behavior disorder.
26651604 2015 Neurite Aggregation and Calcium Dysfunction in iPSC-Derived Sensory Neurons with Parkinson's Disease-Related LRRK2 G2019S Mutation.
More...