Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.42
PubTator Score 7.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cytochrome-c Oxidase Deficiency 17 0.0 0.0
Disease Target Count P-value
cystic fibrosis 1629 5.1e-05
ovarian cancer 8297 1.6e-03
group 3 medulloblastoma 4002 2.5e-03
medulloblastoma, large-cell 6086 1.7e-02
Disease Target Count Z-score Confidence
Microcephaly 166 3.827 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis -1.013 5.1e-05
group 3 medulloblastoma 1.200 2.5e-03
medulloblastoma, large-cell -1.200 1.7e-02
ovarian cancer -1.100 1.6e-03

Protein-protein Interaction (4)

Gene RIF (5)

AA Sequence

MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCDVGVGGFILVT      1 - 70
LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN                           71 - 118
//

Text Mined References (17)

PMID Year Title