Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -2.400 9.6e-04
astrocytic glioma -3.600 1.2e-03
Astrocytoma, Pilocytic -3.300 1.1e-06
atypical teratoid / rhabdoid tumor -5.000 3.9e-10
Breast cancer -1.600 7.4e-04
chronic rhinosinusitis -2.216 4.9e-02
Endometriosis -1.126 1.1e-02
ependymoma -1.700 5.6e-04
glioblastoma -2.900 4.3e-06
group 4 medulloblastoma -3.200 3.4e-05
ileal Crohn's disease -1.252 4.9e-02
lung adenocarcinoma -1.200 9.9e-06
lung carcinoma 1.400 6.6e-03
medulloblastoma, large-cell -3.100 1.6e-02
nasopharyngeal carcinoma -3.200 1.8e-05
oligodendroglioma -3.000 2.3e-02
Pick disease -2.200 1.2e-02
pituitary cancer 1.300 9.1e-04
primitive neuroectodermal tumor -3.100 1.6e-03
subependymal giant cell astrocytoma -2.652 1.7e-02

Gene RIF (1)

AA Sequence

MSHSHPAGLLAAYNSLMDKHLAGYFNNTRIRRHLLRSGLITRSGRILSEKEYKLNMMKRDHQKYIRECLA      1 - 70
QAIFHKVLDMERYHQLEIKKKLETLARKERIQRFKGEHTRRSVENNMPILSPHPPVGPKSNRGHSVLVDE     71 - 140
GHSSPLALTAPRPYTAPGNMQPPIRLQPLPSNPAVETVPKVTSRSRSKTSLLENEALFPIGGKKAVMKFR    141 - 210
NSIGNSQRMNSYQLPNINSYMMPIPPPLPPTGKITRENRSETWRRRRFRPTTAPNGLEPLLTKDSRRIHK    211 - 280
TSLHSNAAITMIYLGKNVHLSSDNPDFRDEIKVYQQHCGGENLCVYKGKLLEKETFQFISKRHHGFPFSL    281 - 350
TFFLNGMQVNRLSSCCEYKHRKGSRLGGKRGYFGFVCVERSSPCYKCIIAMGLDKKPSLPKSRKEKSTEK    351 - 420
GEELKKAEGKVRKEREYVIPKRNEIKENKTSVSAKFSAQEIKTGLKEVVTAVEEMTSKGKPGQEVLEDDQ    421 - 490
ENTLKYEYEEDFEVDEEKQGEKSNEEGQADVQMNGIPQSPLDDKKDNLDPEKESETSSQKAPDARDNVKD    491 - 560
ENDGCSESELEEDKQDMKTASSTSSRSHPYSSDSEDESAVGDREAHTDSSTDESARRSSSQELSENDKPR    561 - 630
KSHLPIEESLEIEIEDQEITKADVETKPMPIDESFENVLKEGTEKGTQEIAEGLSEKSGKHVSAEEKEKD    631 - 700
KSKLWEESTAQVKDKKAGLPGLEEGGKDSLPLAYVLALGAPTMNFMVDETAAINSNKESQQLVQKTYTLE    701 - 770
KKEAMEEDEAPQHRDADIVQGKGEAALWGEAGAVHEAPLRAWKPTAEQPELAEEFTEKREIPPGIERGAE    771 - 840
GAAEAEGVRRLGEGGSDPIGQAAAKDAVGLSKDEAPEKQALMLTVLETDKAASEGEQGLEKAVLANEAAA    841 - 910
LNLEHLHEVAALREAATSEEGEAEGGVAVSDVGESEEEASIDLEDTGPMEDTASKREDGSEEAILGGEEP    911 - 980
AKERKEVMRTETRLSPFTGEAEASRMQVSEGSPEEGSLAKEAFLCKEDVEGEEMVTEAEANREDDRKEIL    981 - 1050
PKELDLARERRKAERPKTSLRKTDSEREEVTRANALKDEDAFKEEQKLKAEEGETETEVRAEEETKAPPN   1051 - 1120
EMGSDAENEAPVEASELSDNPGLLGEDSLKETVVPIFEATPGFEKSLENITALRKEGGGERLSEARDTEH   1121 - 1190
KDREELSSRENRALKEGHRQDGEGALAAPEAEPAGKVQAPEGLIPATGQAEELAAKDHDSCAGLEGRAEG   1191 - 1260
QGGVDVVLRTQEAVAEEDPIMAEKFREEAVDEDPEEEEDKECTLETEAMQDRNSEGDGDMEGEGNTQKNE   1261 - 1330
GMGGGRVVAVEVLHGGGETAETAAEEREVLAGSETAEEKTIANKASSFSDVAEEETWHQQDELVGKTAAA   1331 - 1400
GKVVVEELARSGEEVPAAEEMTVTYTTEAGVGTPGALERKTSGLGQEQEEGSEGQEAATGSGDGRQETGA   1401 - 1470
AEKFRLGLSREGERELSPESLQAMATLPVKPDFTETREKQQHMVQGESETADVSPNNVQV             1471 - 1530
//

Text Mined References (6)

PMID Year Title