Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.12
PubTator Score 1.26

Knowledge Summary

Patent (2,132)

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 4.324 4.4e-05
active ulcerative colitis 2.019 1.7e-02
atypical teratoid / rhabdoid tumor -1.300 3.7e-03
Breast cancer 4.300 2.2e-02
cystic fibrosis 1.900 5.2e-05
glioblastoma multiforme 1.100 3.1e-08
group 4 medulloblastoma -1.200 5.9e-03
head and neck cancer and chronic obstruc... 2.200 2.6e-03
interstitial cystitis 2.100 2.0e-02
intraductal papillary-mucinous carcinoma... -2.000 3.9e-02
invasive ductal carcinoma 2.276 5.9e-05
juvenile dermatomyositis 2.251 4.5e-09
medulloblastoma, large-cell -1.600 1.8e-03
osteosarcoma -2.341 9.0e-04
ovarian cancer -2.400 7.7e-05
pancreatic cancer -1.200 9.0e-05
pancreatic carcinoma -1.200 9.0e-05
Pilocytic astrocytoma 1.100 2.5e-03
primary Sjogren syndrome 2.600 1.3e-06
psoriasis 1.300 3.7e-22
sarcoidosis 2.500 1.1e-02
subependymal giant cell astrocytoma 2.793 1.2e-02
tuberculosis 2.500 2.5e-05

Gene RIF (3)

AA Sequence

MEKFRAVLDLHVKHHSALGYGLVTLLTAGGERIFSAVAFQCPCSAAWNLPYGLVFLLVPALALFLLGYVL      1 - 70
SARTWRLLTGCCSSARASCGSALRGSLVCTQISAAAALAPLTWVAVALLGGAFYECAATGSAAFAQRLCL     71 - 140
GRNRSCAAELPLVPCNQAKASDVQDLLKDLKAQSQVLGWILIAVVIIILLIFTSVTRCLSPVSFLQLKFW    141 - 210
KIYLEQEQQILKSKATEHATELAKENIKCFFEGSHPKEYNTPSMKEWQQISSLYTFNPKGQYYSMLHKYV    211 - 280
NRKEKTHSIRSTEGDTVIPVLGFVDSSGINSTPEL                                       281 - 315
//

Text Mined References (7)

PMID Year Title