Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.19
PubTator Score 1.26

Knowledge Summary

Patent (2,132)

Expression

Gene RIF (2)

PMID Text
25082827 FAM26Fwas found to be consistently and significantly overexpressed in ulcerative colitis patients.
23333304 HIV-1 Vif downregulates the expression of family with sequence similarity 26, member F (FAM26F) in Vif-expression T cells

AA Sequence

MEKFRAVLDLHVKHHSALGYGLVTLLTAGGERIFSAVAFQCPCSAAWNLPYGLVFLLVPALALFLLGYVL      1 - 70
SARTWRLLTGCCSSARASCGSALRGSLVCTQISAAAALAPLTWVAVALLGGAFYECAATGSAAFAQRLCL     71 - 140
GRNRSCAAELPLVPCNQAKASDVQDLLKDLKAQSQVLGWILIAVVIIILLIFTSVTRCLSPVSFLQLKFW    141 - 210
KIYLEQEQQILKSKATEHATELAKENIKCFFEGSHPKEYNTPSMKEWQQISSLYTFNPKGQYYSMLHKYV    211 - 280
NRKEKTHSIRSTEGDTVIPVLGFVDSSGINSTPEL                                       281 - 315
//

Text Mined References (6)

PMID Year Title
27645024 2016 FAM26F: An Enigmatic Protein Having a Complex Role in the Immune System.
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.