Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.19
PubTator Score 1.26

Knowledge Summary

Patent (2,132)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 4.47174192539911E-9
ulcerative colitis 2087 5.19307873659646E-9
glioblastoma multiforme 347 3.05795017736574E-8
psoriasis 6685 4.42980423237254E-8
primary Sjogren syndrome 789 1.30597031009874E-6
ovarian cancer 8492 1.02810197905178E-5
tuberculosis 1563 2.4965180383055E-5
active Crohn's disease 918 4.43218999256876E-5
cystic fibrosis 1670 5.20326802765958E-5
invasive ductal carcinoma 2950 5.85138476157564E-5
pancreatic carcinoma 567 9.03694891538029E-5
pancreatic cancer 2300 9.03694891538062E-5
osteosarcoma 7933 1.07810870197627E-4
medulloblastoma, large-cell 6234 2.30433778016911E-4
group 4 medulloblastoma 1875 2.58830298488608E-4
pilocytic astrocytoma 3086 0.00249314785505889
head and neck cancer and chronic obstructive pulmonary disease 237 0.00258225633508058
atypical teratoid / rhabdoid tumor 4369 0.00370764940239718
sarcoidosis 368 0.0113853400587724
subependymal giant cell astrocytoma 2287 0.0119442311131619
interstitial cystitis 2299 0.0202516630243602
Breast cancer 3099 0.0215258560780546
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0386812350179919

Expression

Synonym

Accession Q5R3K3 B9EJB0 Q5R3K4
Symbols INAM
C6orf187
dJ93H18.5

Gene

Gene RIF (2)

PMID Text
25082827 FAM26Fwas found to be consistently and significantly overexpressed in ulcerative colitis patients.
23333304 HIV-1 Vif downregulates the expression of family with sequence similarity 26, member F (FAM26F) in Vif-expression T cells

AA Sequence

MEKFRAVLDLHVKHHSALGYGLVTLLTAGGERIFSAVAFQCPCSAAWNLPYGLVFLLVPALALFLLGYVL      1 - 70
SARTWRLLTGCCSSARASCGSALRGSLVCTQISAAAALAPLTWVAVALLGGAFYECAATGSAAFAQRLCL     71 - 140
GRNRSCAAELPLVPCNQAKASDVQDLLKDLKAQSQVLGWILIAVVIIILLIFTSVTRCLSPVSFLQLKFW    141 - 210
KIYLEQEQQILKSKATEHATELAKENIKCFFEGSHPKEYNTPSMKEWQQISSLYTFNPKGQYYSMLHKYV    211 - 280
NRKEKTHSIRSTEGDTVIPVLGFVDSSGINSTPEL                                       281 - 315
//

Text Mined References (6)

PMID Year Title
27645024 2016 FAM26F: An Enigmatic Protein Having a Complex Role in the Immune System.
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.