Property Summary

Ligand Count 4
NCBI Gene PubMed Count 1
PubMed Score 1978.48
PubTator Score 1.44

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 GO Component (1)

Gene RIF (2)

AA Sequence

MKVIAILTLLLFCSPTHSSFWQFQRRVKHITGRSAFFSYYGYGCYCGLGDKGIPVDDTDRHSPSSPSPYE      1 - 70
KLKEFSCQPVLNSYQFHIVNGAVVCGCTLGPGASCHCRLKACECDKQSVHCFKESLPTYEKNFKQFSSQP     71 - 140
RCGRHKPWC                                                                 141 - 149
//

Text Mined References (3)

PMID Year Title