Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.70
PubTator Score 1.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Aspergillosis 23 3.396 1.7

Expression

Gene RIF (3)

PMID Text
9745929 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor
9745929 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor
9377118 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor

AA Sequence

MKVIAILTLLLFCSPTHSSFWQFQRRVKHITGRSAFFSYYGYGCYCGLGDKGIPVDDTDRHSPSSPSPYE      1 - 70
KLKEFSCQPVLNSYQFHIVNGAVVCGCTLGPGASCHCRLKACECDKQSVHCFKESLPTYEKNFKQFSSQP     71 - 140
RCGRHKPWC                                                                 141 - 149
//

Text Mined References (3)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
8838795 1996 Low-molecular-weight, calcium-dependent phospholipase A2 genes are linked and map to homologous chromosome regions in mouse and human.
2708461 1989 Novel gene exon homologous to pancreatic phospholipase A2: sequence and chromosomal mapping of both human genes.