Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer -1.200 7.3e-03
malignant mesothelioma 1.300 6.3e-06
osteosarcoma -1.052 3.3e-03
pancreatic ductal adenocarcinoma liver m... -1.626 1.1e-02
subependymal giant cell astrocytoma -1.064 4.0e-02

Protein-protein Interaction (9)

AA Sequence

MFPFGPHSPGGDGSAGAGAEEPTPHEGQAAATGPPSPLHPGADATHPPPPARSPRRPGAPSLSPAPRSGE      1 - 70
LGLPGAPESSTASAPGEPSPPSPPCRRPGPDCRAKSRGRHGLGAGLGGPGARLFGWLKERSLGRGLFVDP     71 - 140
ARDNFRTMTSLYGSIHPADSVYLSTRTHGAVFNLEYSPDGSVLTVACEQTEVLLFDPISSKHIKTLSEAH    141 - 210
EDCVNNIRFLDNRLFATCSDDTTIALWDLRKLNTKVCTLHGHTSWVKNIEYDTNTRLLVTSGFDGNVIIW    211 - 280
DTNRYTEDGCPHKKFFHTRFLMRMRLTPDCSKMLISTSSGYLLILHDLDLTKSLEVGSYPILRARRTTSS    281 - 350
SDLTTSSSSSGPRVSGSPCHHSDSNSSEKHMSRASQREGVSPRNSLEVVTPEVLGESDHGNCITSLQLHP    351 - 420
KGWATLLRCSSNSDDEECTCVYEFQEGAPVRPVSPRCSLRLTHYIEEANVGRGYIKELCFSPDGRMISSP    421 - 490
HGYGIRLLGFDKQCSELVDCLPKEASPLRVIRSLYSHNDVVLTTKFSPTHCQIASGCLSGRVSLYQPKF     491 - 559
//

Text Mined References (11)

PMID Year Title