Property Summary

NCBI Gene PubMed Count 10
Grant Count 10
R01 Count 9
Funding $616,352.66
PubMed Score 9.78
PubTator Score 10.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (5)

PMID Text
24708996 c-Src-mediated signal positively regulates ACER activity in a Ca2+-independent manner.
20628055 Results suggest that up-regulation of the ACER2/DHS pathway mediates the cytotoxicity of 4-HPR in tumor cells and that up-regulating or activating ACER2 may improve the anti-cancer activity of 4-HRR and other DHC-inducing agents.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20089856 ACER2 has broad substrate specificity and requires Ca(2+) for its activity; ACER2 has the cytosolic C terminus and luminal N terminus, which are essential for its activity, correct cellular localization, and regulation for protein glycosylation
18945876 ACER2/sphingosine pathway plays an important role in regulating beta1 maturation and cell adhesion mediated by beta1 integrins

AA Sequence

MGAPHWWDQLQAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFILPPICMCLFRQYATCFNSGIYLIWTL      1 - 70
LVVVGIGSVYFHATLSFLGQMLDELAVLWVLMCALAMWFPRRYLPKIFRNDRGRFKVVVSVLSAVTTCLA     71 - 140
FVKPAINNISLMTLGVPCTALLIAELKRCDNMRVFKLGLFSGLWWTLALFCWISDRAFCELLSSFNFPYL    141 - 210
HCMWHILICLAAYLGCVCFAYFDAASEIPEQGPVIKFWPNEKWAFIGVPYVSLLCANKKSSVKIT         211 - 275
//

Text Mined References (10)

PMID Year Title
24708996 2014 Regulation of alkaline ceramidase activity by the c-Src-mediated pathway.
20628055 2010 Alkaline ceramidase 2 (ACER2) and its product dihydrosphingosine mediate the cytotoxicity of N-(4-hydroxyphenyl)retinamide in tumor cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20089856 2010 Substrate specificity, membrane topology, and activity regulation of human alkaline ceramidase 2 (ACER2).
18945876 2009 Alkaline ceramidase 2 regulates beta1 integrin maturation and cell adhesion.
16940153 2006 Golgi alkaline ceramidase regulates cell proliferation and survival by controlling levels of sphingosine and S1P.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.