Property Summary

NCBI Gene PubMed Count 4
PubMed Score 8.71
PubTator Score 7.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Lichen planus 17 3.344 1.7
psoriasis 6,685

Synonym

Accession Q5QJ38 B2RPK8 Q5VTJ9
Symbols THHL1
S100A17

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
23376073 These findings highlight the possibility that TCHHL1 proteins are expressed in growing keratinocytes of the epidermis and might be associated with the proliferation of keratinocytes.
21614011 We identified and characterized a novel S100 fused type protein expressed in hair follicles

AA Sequence

MPQLLRNVLCVIETFHKYASEDSNGATLTGRELKQLIQGEFGDFFQPCVLHAVEKNSNLLNIDSNGIISF      1 - 70
DEFVLAIFNLLNLCYLDIKSLLSSELRQVTKPEKEKLDDVDVQATTGDGQWTVGTSPTQEKRMLPSGMAS     71 - 140
SSQLIPEESGAVGNNRVDPWREAKTHNFPGEASEHNDPKNKHLEGDEQSQEVAQDIQTTEDNEGQLKTNK    141 - 210
PMAGSKKTSSPTERKGQDKEISQEGDEPAREQSVSKIRDQFGEQEGNLATQSSPPKEATQRPCEDQEVRT    211 - 280
EKEKHSNIQEPPLQREDEPSSQHADLPEQAAARSPSQTQKSTDSKDVCRMFDTQEPGKDADQTPAKTKNL    281 - 350
GEPEDYGRTSETQEKECETKDLPVQYGSRNGSETSDMRDERKERRGPEAHGTAGQKERDRKTRPLVLETQ    351 - 420
TQDGKYQELQGLSKSKDAEKGSETQYLSSEGGDQTHPELEGTAVSGEEAEHTKEGTAEAFVNSKNAPAAE    421 - 490
RTLGARERTQDLAPLEKQSVGENTRVTKTHDQPVEEEDGYQGEDPESPFTQSDEGSSETPNSLASEEGNS    491 - 560
SSETGELPVQGDSQSQGDQHGESVQGGHNNNPDTQRQGTPGEKNRALEAVVPAVRGEDVQLTEDQEQPAR    561 - 630
GEHKNQGPGTKGPGAAVEPNGHPEAQESTAGDENRKSLEIEITGALDEDFTDQLSLMQLPGKGDSRNELK    631 - 700
VQGPSSKEEKGRATEAQNTLLESLDEDNSASLKIQLETKEPVTSEEEDESPQELAGEGGDQKSPAKKEHN    701 - 770
SSVPWSSLEKQMQRDQEPCSVERGAVYSSPLYQYLQEKILQQTNVTQEEHQKQVQIAQASGPELCSVSLT    771 - 840
SEISDCSVFFNYSQASQPYTRGLPLDESPAGAQETPAPQALEDKQGHPQRERLVLQREASTTKQ          841 - 904
//

Text Mined References (6)

PMID Year Title
23376073 2013 Trichohyalin-like 1 protein, a member of fused S100 proteins, is expressed in normal and pathologic human skin.
21614011 2011 Identification of trichohyalin-like 1, an s100 fused-type protein selectively expressed in hair follicles.
20585627 2010 Web-based, participant-driven studies yield novel genetic associations for common traits.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.