Property Summary

NCBI Gene PubMed Count 17
Grant Count 13
R01 Count 10
Funding $1,349,131.68
PubMed Score 21.88
PubTator Score 34.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -6.086 0.000
tuberculosis 2.900 0.000
non-small cell lung cancer -1.885 0.000
interstitial cystitis 1.400 0.007
lung carcinoma -2.600 0.000
ovarian cancer -1.400 0.000

Gene RIF (14)

PMID Text
26095365 Antibacterial autophagy is impaired in CLEC12A-deficient cells, and this effect is exacerbated in the presence of the ATG16L1( *)300A risk allele.
25957656 We propose the hypothesis that decreased expression of CLEC12A is a common denominator in the hyperinflammatory responses observed in Behcet's syndrome and gout.
25760768 Upon CLL1-selective binding of this fusion protein, granulocytes acquire additional TRAIL-mediated cytotoxic activity that, importantly, potentiates antibody-mediated cytotoxicity of clinically used therapeutic antibodies
24152218 We conclude the hMICL/CD123-based MFC assay is a promising MRD tool in AML.
22341585 There is a potential genetic association of CLEC12A with rheumatoid arthritis (RA). Since CLEC12A encodes for the myeloid inhibitory C-type lectin-like receptor that modulates cytokine synthesis, this receptor may contribute to the pathogenesis of RA.
21677141 For production of cytotoxic T cells, transgenic DEC-205 and Clec9A, but not Clec12A, are effective targets for antibody-mediated delivery of antigens for vaccination, although only in the presence of adjuvants.
19494282 Anti-Clec12A mAb alone produced only moderate responses, but these were amplified by coinjecting only small amounts of LPS as a dendritic cell activation agent
18350551 mMICL recognises an endogenous ligand in a variety of murine tissues, suggesting that the receptor plays a role in homeostasis
17609428 CLL-1 expression is also present on the CD34(+)CD38(-) stem- cell compartment in acute myeloid leukemia
16838277 human MICL may be involved in the control of myeloid cell activation during inflammation
More...

AA Sequence

MSEEVTYADLQFQNSSEMEKIPEIGKFGEKAPPAPSHVWRPAALFLTLLCLLLLIGLGVLASMFHVTLKI      1 - 70
EMKKMNKLQNISEELQRNISLQLMSNMNISNKIRNLSTTLQTIATKLCRELYSKEQEHKCKPCPRRWIWH     71 - 140
KDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIIN    141 - 210
SSAWVIRNAPDLNNMYCGYINRLYVQYYHCTYKKRMICEKMANPVQLGSTYFREA                   211 - 265
//

Text Mined References (21)

PMID Year Title
26095365 2015 Integrated Genomics of Crohn's Disease Risk Variant Identifies a Role for CLEC12A in Antibacterial Autophagy.
25957656 2015 C-type lectin domain family 12, member A: A common denominator in Behçet's syndrome and acute gouty arthritis.
25760768 2015 C-type lectin-like molecule-1 (CLL1)-targeted TRAIL augments the tumoricidal activity of granulocytes and potentiates therapeutic antibody-dependent cell-mediated cytotoxicity.
24152218 2014 hMICL and CD123 in combination with a CD45/CD34/CD117 backbone - a universal marker combination for the detection of minimal residual disease in acute myeloid leukaemia.
22341585 2012 A genetic association study of the CLEC12A gene in rheumatoid arthritis.
21677141 2011 Targeting antigen to mouse dendritic cells via Clec9A induces potent CD4 T cell responses biased toward a follicular helper phenotype.
19494282 2009 The C-type lectin Clec12A present on mouse and human dendritic cells can serve as a target for antigen delivery and enhancement of antibody responses.
18350551 2008 Characterisation of murine MICL (CLEC12A) and evidence for an endogenous ligand.
17609428 2007 The novel AML stem cell associated antigen CLL-1 aids in discrimination between normal and leukemic stem cells.
16838277 2006 Human MICL (CLEC12A) is differentially glycosylated and is down-regulated following cellular activation.
More...