| Tbio | C-type lectin domain family 12 member A |
Cell surface receptor that modulates signaling cascades and mediates tyrosine phosphorylation of target MAP kinases.
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The protein encoded by this gene is a negative regulator of granulocyte and monocyte function. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. This gene is closely linked to other CTL/CTLD superfamily members in the natural killer gene complex region on chromosome 12p13. [provided by RefSeq, May 2011]
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The protein encoded by this gene is a negative regulator of granulocyte and monocyte function. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. This gene is closely linked to other CTL/CTLD superfamily members in the natural killer gene complex region on chromosome 12p13. [provided by RefSeq, May 2011]
Comments
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Arthritis, Rheumatoid | 174 | 0.0 | 0.0 |
| Disease | Target Count |
|---|---|
| Rheumatoid arthritis | 1191 |
| Disease | Target Count | P-value |
|---|---|---|
| non-small cell lung cancer | 2890 | 2.4e-25 |
| lung carcinoma | 2843 | 3.5e-20 |
| osteosarcoma | 7950 | 4.2e-07 |
| tuberculosis | 2010 | 6.2e-07 |
| ovarian cancer | 8520 | 1.4e-05 |
| interstitial cystitis | 2312 | 7.2e-03 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| acute myeloid leukemia | 783 | 3.492 | 1.7 |
| Disease | log2 FC | p |
|---|---|---|
| interstitial cystitis | 1.400 | 7.2e-03 |
| lung carcinoma | -2.600 | 3.5e-20 |
| non-small cell lung cancer | -1.885 | 2.4e-25 |
| osteosarcoma | -6.086 | 4.2e-07 |
| ovarian cancer | -1.400 | 1.4e-05 |
| tuberculosis | 2.900 | 6.2e-07 |
MSEEVTYADLQFQNSSEMEKIPEIGKFGEKAPPAPSHVWRPAALFLTLLCLLLLIGLGVLASMFHVTLKI 1 - 70 EMKKMNKLQNISEELQRNISLQLMSNMNISNKIRNLSTTLQTIATKLCRELYSKEQEHKCKPCPRRWIWH 71 - 140 KDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIIN 141 - 210 SSAWVIRNAPDLNNMYCGYINRLYVQYYHCTYKKRMICEKMANPVQLGSTYFREA 211 - 265 //
