Property Summary

NCBI Gene PubMed Count 19
PubMed Score 26.75
PubTator Score 34.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Rheumatoid 174 0.0 0.0
Disease Target Count
Rheumatoid arthritis 1191
Disease Target Count P-value
non-small cell lung cancer 2890 2.4e-25
lung carcinoma 2843 3.5e-20
osteosarcoma 7950 4.2e-07
tuberculosis 2010 6.2e-07
ovarian cancer 8519 1.4e-05
interstitial cystitis 2312 7.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
acute myeloid leukemia 783 3.492 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial cystitis 1.400 7.2e-03
lung carcinoma -2.600 3.5e-20
non-small cell lung cancer -1.885 2.4e-25
osteosarcoma -6.086 4.2e-07
ovarian cancer -1.400 1.4e-05
tuberculosis 2.900 6.2e-07

 GO Function (1)

 GO Process (1)

Gene RIF (16)

AA Sequence

MSEEVTYADLQFQNSSEMEKIPEIGKFGEKAPPAPSHVWRPAALFLTLLCLLLLIGLGVLASMFHVTLKI      1 - 70
EMKKMNKLQNISEELQRNISLQLMSNMNISNKIRNLSTTLQTIATKLCRELYSKEQEHKCKPCPRRWIWH     71 - 140
KDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIIN    141 - 210
SSAWVIRNAPDLNNMYCGYINRLYVQYYHCTYKKRMICEKMANPVQLGSTYFREA                   211 - 265
//

Text Mined References (23)

PMID Year Title