Tbio | C-type lectin domain family 12 member A |
Cell surface receptor that modulates signaling cascades and mediates tyrosine phosphorylation of target MAP kinases.
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The protein encoded by this gene is a negative regulator of granulocyte and monocyte function. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. This gene is closely linked to other CTL/CTLD superfamily members in the natural killer gene complex region on chromosome 12p13. [provided by RefSeq, May 2011]
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The protein encoded by this gene is a negative regulator of granulocyte and monocyte function. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. This gene is closely linked to other CTL/CTLD superfamily members in the natural killer gene complex region on chromosome 12p13. [provided by RefSeq, May 2011]
Comments
Disease | Target Count |
---|---|
Rheumatoid Arthritis | 1171 |
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2798 | 2.387347279919E-25 |
lung carcinoma | 2844 | 3.49944668199597E-20 |
osteosarcoma | 7933 | 4.17453879118992E-7 |
tuberculosis | 1563 | 6.1968800894783E-7 |
ovarian cancer | 8492 | 1.38246898883886E-5 |
interstitial cystitis | 2299 | 0.00716940483574598 |
Disease | log2 FC | p |
---|---|---|
osteosarcoma | -6.086 | 0.000 |
tuberculosis | 2.900 | 0.000 |
non-small cell lung cancer | -1.885 | 0.000 |
interstitial cystitis | 1.400 | 0.007 |
lung carcinoma | -2.600 | 0.000 |
ovarian cancer | -1.400 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA Inparanoid |
Dog | OMA EggNOG |
Cow | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26095365 | Antibacterial autophagy is impaired in CLEC12A-deficient cells, and this effect is exacerbated in the presence of the ATG16L1( *)300A risk allele. |
25957656 | We propose the hypothesis that decreased expression of CLEC12A is a common denominator in the hyperinflammatory responses observed in Behcet's syndrome and gout. |
25760768 | Upon CLL1-selective binding of this fusion protein, granulocytes acquire additional TRAIL-mediated cytotoxic activity that, importantly, potentiates antibody-mediated cytotoxicity of clinically used therapeutic antibodies |
24152218 | We conclude the hMICL/CD123-based MFC assay is a promising MRD tool in AML. |
22341585 | There is a potential genetic association of CLEC12A with rheumatoid arthritis (RA). Since CLEC12A encodes for the myeloid inhibitory C-type lectin-like receptor that modulates cytokine synthesis, this receptor may contribute to the pathogenesis of RA. |
21677141 | For production of cytotoxic T cells, transgenic DEC-205 and Clec9A, but not Clec12A, are effective targets for antibody-mediated delivery of antigens for vaccination, although only in the presence of adjuvants. |
19494282 | Anti-Clec12A mAb alone produced only moderate responses, but these were amplified by coinjecting only small amounts of LPS as a dendritic cell activation agent |
18350551 | mMICL recognises an endogenous ligand in a variety of murine tissues, suggesting that the receptor plays a role in homeostasis |
17609428 | CLL-1 expression is also present on the CD34(+)CD38(-) stem- cell compartment in acute myeloid leukemia |
16838277 | human MICL may be involved in the control of myeloid cell activation during inflammation |
More... |
MSEEVTYADLQFQNSSEMEKIPEIGKFGEKAPPAPSHVWRPAALFLTLLCLLLLIGLGVLASMFHVTLKI 1 - 70 EMKKMNKLQNISEELQRNISLQLMSNMNISNKIRNLSTTLQTIATKLCRELYSKEQEHKCKPCPRRWIWH 71 - 140 KDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIIN 141 - 210 SSAWVIRNAPDLNNMYCGYINRLYVQYYHCTYKKRMICEKMANPVQLGSTYFREA 211 - 265 //
PMID | Year | Title |
---|---|---|
26095365 | 2015 | Integrated Genomics of Crohn's Disease Risk Variant Identifies a Role for CLEC12A in Antibacterial Autophagy. |
25957656 | 2015 | C-type lectin domain family 12, member A: A common denominator in Behçet's syndrome and acute gouty arthritis. |
25760768 | 2015 | C-type lectin-like molecule-1 (CLL1)-targeted TRAIL augments the tumoricidal activity of granulocytes and potentiates therapeutic antibody-dependent cell-mediated cytotoxicity. |
24152218 | 2014 | hMICL and CD123 in combination with a CD45/CD34/CD117 backbone - a universal marker combination for the detection of minimal residual disease in acute myeloid leukaemia. |
22341585 | 2012 | A genetic association study of the CLEC12A gene in rheumatoid arthritis. |
21677141 | 2011 | Targeting antigen to mouse dendritic cells via Clec9A induces potent CD4 T cell responses biased toward a follicular helper phenotype. |
19494282 | 2009 | The C-type lectin Clec12A present on mouse and human dendritic cells can serve as a target for antigen delivery and enhancement of antibody responses. |
18350551 | 2008 | Characterisation of murine MICL (CLEC12A) and evidence for an endogenous ligand. |
17609428 | 2007 | The novel AML stem cell associated antigen CLL-1 aids in discrimination between normal and leukemic stem cells. |
16838277 | 2006 | Human MICL (CLEC12A) is differentially glycosylated and is down-regulated following cellular activation. |
More... |