Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 1.3e-06

Synonym

Accession Q5QFB9
Symbols DIPAS
TAF4B
PAPPAS
TAF2C2
PAPPAAS
PAPPA-AS
TAFII105
NCRNA00156

AA Sequence

MRYGFVRKKHRGLFLTTVAALPIWNPISEFVKWYKSHKLSQHCIRICGHLCQKHLDMFLSVIGQRWPIDV      1 - 70
FSSVFDHQVSAIGSDIIWWFLKLFLVSFFFFF                                           71 - 102
//

Text Mined References (3)

PMID Year Title