Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung carcinoma 2,844

Synonym

Accession Q5QFB9
Symbols DIPAS
TAF4B
PAPPAS
TAF2C2
PAPPAAS
PAPPA-AS
TAFII105
NCRNA00156

Gene

AA Sequence

MRYGFVRKKHRGLFLTTVAALPIWNPISEFVKWYKSHKLSQHCIRICGHLCQKHLDMFLSVIGQRWPIDV      1 - 70
FSSVFDHQVSAIGSDIIWWFLKLFLVSFFFFF                                           71 - 102
//

Text Mined References (3)

PMID Year Title
15656990 2005 Identification of two novel human genes, DIPLA1 and DIPAS, expressed in placenta tissue.
15450385 Differential display RT-PCR analysis of human choriocarcinoma cell lines and normal term trophoblast cells: identification of new genes expressed in placenta.
15164053 2004 DNA sequence and analysis of human chromosome 9.