Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.15
PubTator Score 102.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Expression

  Differential Expression (1)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... -1.480 0.014

Gene RIF (1)

PMID Text
17632081 Molecular cloning and characterization of SLC10A5 as an orphan carrier with yet non-identified substrates.

AA Sequence

MIRKLFIVLLLLLVTIEEARMSSLSFLNIEKTEILFFTKTEETILVSSSYENKRPNSSHLFVKIEDPKIL      1 - 70
QMVNVAKKISSDATNFTINLVTDEEGETNVTIQLWDSEGRQERLIEEIKNVKVKVLKQKDSLLQAPMHID     71 - 140
RNILMLILPLILLNKCAFGCKIELQLFQTVWKRPLPVILGAVTQFFLMPFCGFLLSQIVALPEAQAFGVV    141 - 210
MTCTCPGGGGGYLFALLLDGDFTLAILMTCTSTLLALIMMPVNSYIYSRILGLSGTFHIPVSKIVSTLLF    211 - 280
ILVPVSIGIVIKHRIPEKASFLERIIRPLSFILMFVGIYLTFTVGLVFLKTDNLEVILLGLLVPALGLLF    281 - 350
GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAPFTVAMCSGCEMLLIILVYKA    351 - 420
KKRCIFFLQDKRKRNFLI                                                        421 - 438
//

Text Mined References (6)

PMID Year Title
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
17632081 2007 The novel putative bile acid transporter SLC10A5 is highly expressed in liver and kidney.
16541252 2006 The solute carrier family SLC10: more than a family of bile acid transporters regarding function and phylogenetic relationships.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.