Property Summary

NCBI Gene PubMed Count 15
PubMed Score 9.61
PubTator Score 4.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 6.6e-10
glioblastoma 5792 2.9e-05
medulloblastoma 720 1.1e-03
pancreatic ductal adenocarcinoma liver metastasis 1962 1.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Salivary gland adenoid cystic carcinoma 6 3.283 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma 1.300 2.9e-05
medulloblastoma 1.100 1.1e-03
osteosarcoma 2.176 6.6e-10
pancreatic ductal adenocarcinoma liver m... 1.632 1.7e-03

Gene RIF (3)

AA Sequence

MMFRDQVGILAGWFKGWNECEQTVALLSLLKRVTRTQARFLQLCLEHSLADCNDIHLLESEANSAAIVSQ      1 - 70
WQQESKEKVVSLLLSHLPLLQPGNTEAKSEYMRLLQKVLAYSIESNAFIEESRQLLSYALIHPATTLEDR     71 - 140
NALALWLSHLEERLASGFRSRPEPSYHSRQGSDEWGGPAELGPGEAGPGWQDKPPRENGHVPFHPSSSVP    141 - 210
PAINSIGSNANTGLPCQIHPSPLKRSMSLIPTSPQVPGEWPSPEELGARAAFTTPDHAPLSPQSSVASSG    211 - 280
SEQTEEQGSSRNTFQEDGSGMKDVPSWLKSLRLHKYAALFSQMSYEEMMTLTEQHLESQNVTKGARHKIA    281 - 350
LSIQKLRERQSVLKSLEKDVLEGGNLRNALQELQQIIITPIKAYSVLQATVAAATTTPTAKDGAPGEPPL    351 - 420
PGAEPPLAHPGTDKGTEAKDPPAVENYPPPPAPAPTDGSEPAPAPVADGDIPSQFTRVMGKVCTQLLVSR    421 - 490
PDEENITSYLQLIEKCLTHEAFTETQKKRLLSWKQQVLKLLRTFPRKAALEMQNYRQQKGWAFGSNSLPI    491 - 560
AGSVGMGVARRTQRQFPMPPRALPPGRMGLLSPSGIGGVSPRHALTSPSLGGQGRQNLWFANPGGSNSMP    561 - 630
SQSRSSVQRTHSLPVHSSPQAILMFPPDCPVPGPDLEINPTLESLCLSMTEHALGDGTDKTSTI          631 - 694
//

Text Mined References (22)

PMID Year Title