Property Summary

NCBI Gene PubMed Count 14
PubMed Score 36.98
PubTator Score 21.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Lipoidosis 19
Disease Target Count P-value
pituitary cancer 1972 2.84297624065929E-8
group 4 medulloblastoma 1875 7.04103190508143E-7
malignant mesothelioma 3163 3.73071870732718E-6
interstitial cystitis 2299 3.69781486263138E-5
ovarian cancer 8492 2.72245498016576E-4
Multiple myeloma 1328 7.41460915251378E-4
medulloblastoma, large-cell 6234 0.00129900394862659
dermatomyositis 967 0.00346709672661185
psoriasis 6685 0.00389741520678749
active Crohn's disease 918 0.00453170822295783
mucosa-associated lymphoid tissue lymphoma 480 0.00715994503436383
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0157119242872846
glioblastoma 5572 0.0178631519319843
osteosarcoma 7933 0.0198270588682765
colon cancer 1475 0.0206367916896231
non primary Sjogren syndrome sicca 840 0.0238202461046868
subependymal giant cell astrocytoma 2287 0.0391272552197667
pulmonary arterial hypertension 36 0.0447930564683464
astrocytic glioma 2241 0.0481662172662587

Expression

  Differential Expression (19)

Synonym

Accession Q5MNZ9 Q8IXM5 Q9NWF8 WIPI-1
Symbols ATG18
ATG18A
WIPI49

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (9)

PMID Text
25462558 The specific autophagosomal localization of both WIPI1 and WIPI2 (refered to as WIPI puncta) has been employed to assess autophagy using fluorescence microscopy methods, such as confocal and live-cell video microscopy
25233424 Data suggest WIPI1/WIPI2 co-localize with microtubule-associated light chain 3 and autophagy related proteins 2/14L, participate in biogenesis of phagosomes, autophagy, and mobilization of lipids to/from intracellular droplets. [review-like article]
24991767 WIPI-1 and WIPI-2 are functionally required in mediating the PI3P signal at the onset of autophagy in NB4 cells.
24384561 the detection of WIPI1 mRNA is likely to be a convenient method of monitoring autophagosome formation in a wide range of cell types
21564513 Freeze-fracture replica immunolabelling reveals WD-repeat protein interacting with phosphoinositides 1 and 2 (WIPI-1 and WIPI-2) as membrane components of autophagosomes and the plasma membrane (PM).
21317285 Studies define a distinct role for WIPI1 and TORC1 signaling in controlling the transcription of melanogenic enzymes and melanosome maturation, a process that is distinct from starvation-induced autophagy.
19936222 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17618624 Quantification of WIPI-1 puncta should be suitable to assay mammalian autophagy
15602573 share an evolutionary conserved function in autophagy and that autophagic capacity may be compromised in human cancers

AA Sequence

MEAEAADAPPGGVESALSCFSFNQDCTSLATGTKAGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSS      1 - 70
LVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEESIYIHNIKDMKLLKTLLDIPA     71 - 140
NPTGLCALSINHSNSYLAYPGSLTSGEIVLYDGNSLKTVCTIAAHEGTLAAITFNASGSKLASASEKGTV    141 - 210
IRVFSVPDGQKLYEFRRGMKRYVTISSLVFSMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMG    211 - 280
KMFMAATNYLPTQVSDMMHQDRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGE    281 - 350
CVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGP    351 - 420
VCLDDENEFPPIILCRGNQKGKTKQS                                                421 - 446
//

Text Mined References (24)

PMID Year Title
25462558 2015 Fluorescence-based imaging of autophagy progression by human WIPI protein detection.
25233424 2014 WIPI ?-propellers at the crossroads of autophagosome and lipid droplet dynamics.
24991767 2014 WIPI-dependent autophagy during neutrophil differentiation of NB4 acute promyelocytic leukemia cells.
24384561 2014 Detection of WIPI1 mRNA as an indicator of autophagosome formation.
23088497 2012 Defining regulatory and phosphoinositide-binding sites in the human WIPI-1 ?-propeller responsible for autophagosomal membrane localization downstream of mTORC1 inhibition.
22829830 2012 WIPI-1 Positive Autophagosome-Like Vesicles Entrap Pathogenic Staphylococcus aureus for Lysosomal Degradation.
21896713 2011 Ca2+/calmodulin-dependent kinase (CaMK) signaling via CaMKI and AMP-activated protein kinase contributes to the regulation of WIPI-1 at the onset of autophagy.
21564513 2011 Freeze-fracture replica immunolabelling reveals human WIPI-1 and WIPI-2 as membrane proteins of autophagosomes.
21317285 2011 WIPI1 coordinates melanogenic gene transcription and melanosome formation via TORC1 inhibition.
20639694 2010 Characterization of autophagosome formation site by a hierarchical analysis of mammalian Atg proteins.
More...