Property Summary

NCBI Gene PubMed Count 14
PubMed Score 43.49
PubTator Score 21.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.082 4.5e-03
astrocytic glioma -1.600 4.8e-02
colon cancer -1.300 2.1e-02
dermatomyositis 1.400 3.5e-03
glioblastoma 1.300 1.8e-02
group 3 medulloblastoma -1.300 5.4e-05
interstitial cystitis 1.600 3.7e-05
intraductal papillary-mucinous carcinoma... 1.100 1.6e-02
malignant mesothelioma -1.100 3.7e-06
medulloblastoma, large-cell -1.500 9.4e-04
mucosa-associated lymphoid tissue lympho... 1.937 7.2e-03
Multiple myeloma 1.733 7.4e-04
non primary Sjogren syndrome sicca 1.100 2.4e-02
osteosarcoma -1.265 2.0e-02
ovarian cancer 1.800 1.1e-03
pituitary cancer -2.200 2.8e-08
psoriasis -1.100 3.9e-03
pulmonary arterial hypertension -1.300 4.5e-02
subependymal giant cell astrocytoma 1.114 3.9e-02

Gene RIF (9)

AA Sequence

MEAEAADAPPGGVESALSCFSFNQDCTSLATGTKAGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSS      1 - 70
LVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEESIYIHNIKDMKLLKTLLDIPA     71 - 140
NPTGLCALSINHSNSYLAYPGSLTSGEIVLYDGNSLKTVCTIAAHEGTLAAITFNASGSKLASASEKGTV    141 - 210
IRVFSVPDGQKLYEFRRGMKRYVTISSLVFSMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMG    211 - 280
KMFMAATNYLPTQVSDMMHQDRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGE    281 - 350
CVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGP    351 - 420
VCLDDENEFPPIILCRGNQKGKTKQS                                                421 - 446
//

Text Mined References (24)

PMID Year Title