Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.7e-04
Multiple myeloma 1332 1.9e-04
ovarian cancer 8520 1.2e-03
Disease Target Count Z-score Confidence
Cerebral palsy 40 3.3 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.111 1.9e-04
ovarian cancer 1.500 1.2e-03
psoriasis 1.500 1.7e-04

Synonym

Accession Q5MNZ6 O95328 Q2MCP6 Q6IBN2 WIPI-3
Symbols WIPI3
WDR45L
WIPI-3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MNLLPCNPHGNGLLYAGFNQDHGCFACGMENGFRVYNTDPLKEKEKQEFLEGGVGHVEMLFRCNYLALVG      1 - 70
GGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVVVLDSMIKVFTFTHNPHQLHVFETCYN     71 - 140
PKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPPVDIPAHEGVLSCIALNLQGTRIATASEKGTLI    141 - 210
RIFDTSSGHLIQELRRGSQAANIYCINFNQDASLICVSSDHGTVHIFAAEDPKRNKQSSLASASFLPKYF    211 - 280
SSKWSFSKFQVPSGSPCICAFGTEPNAVIAICADGSYYKFLFNPKGECIRDVYAQFLEMTDDKL          281 - 344
//

Text Mined References (7)

PMID Year Title