Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Intellectual disability 573
Disease Target Count P-value
psoriasis 6685 1.74765388686006E-4
Multiple myeloma 1328 1.87733725976129E-4
ovarian cancer 8492 0.00121135999664795

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.111 0.000
psoriasis 1.500 0.000
ovarian cancer 1.500 0.001

Synonym

Accession Q5MNZ6 O95328 Q2MCP6 Q6IBN2 WIPI-3
Symbols WIPI3
WDR45L
WIPI-3

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

AA Sequence

MNLLPCNPHGNGLLYAGFNQDHGCFACGMENGFRVYNTDPLKEKEKQEFLEGGVGHVEMLFRCNYLALVG      1 - 70
GGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVVVLDSMIKVFTFTHNPHQLHVFETCYN     71 - 140
PKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPPVDIPAHEGVLSCIALNLQGTRIATASEKGTLI    141 - 210
RIFDTSSGHLIQELRRGSQAANIYCINFNQDASLICVSSDHGTVHIFAAEDPKRNKQSSLASASFLPKYF    211 - 280
SSKWSFSKFQVPSGSPCICAFGTEPNAVIAICADGSYYKFLFNPKGECIRDVYAQFLEMTDDKL          281 - 344
//

Text Mined References (6)

PMID Year Title
15602573 2004 WIPI-1alpha (WIPI49), a member of the novel 7-bladed WIPI protein family, is aberrantly expressed in human cancer and is linked to starvation-induced autophagy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15020712 2004 PtdIns-specific MPR pathway association of a novel WD40 repeat protein, WIPI49.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.