Property Summary

NCBI Gene PubMed Count 20
PubMed Score 37.82
PubTator Score 24.28

Knowledge Summary


No data available



Accession Q5MJ70 Q53R05 Q5MJ69
Symbols SPY1


  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Pig OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (13)

26644004 Spy1 participates in the proliferation and apoptosis of epithelial ovarian cancer.
26017671 A novel Spy1-CLIPR-59 interplay was identified in glioblastoma resistance to TNF-alpha.
25526860 CRMP1 interacted with Spy1 which would disturb the association of CRMP1 with actin and was involved in the collapse of growth cones induced by Sema3A and regeneration after sciatic nerve crush.
24434210 we demonstrate that the atypical cyclin-like protein Spy1 plays a role in balancing the division properties of glioma cells with stemness properties
24037419 Cell adhesion to fibronectin down-regulates the expression of Spy1 and contributes to drug resistance in multiple myeloma cells.
22492278 Our results suggest that Spy1 may be a possible prognostic indicator in NHLs, and it was correlated with phosphorylation of p27(Kip1) on Thr187
22447439 Spy1 expression positively correlates with the malignancy of gliomas.
19686732 Spy1 overexpression is involved in the pathogenesis of hepatocellular carcinoma, it may be a favorable independent poor prognostic parameter for hepatocellular carcinoma.
19622356 Data show that tight regulation of RINGO/Speedy A is important for the somatic cell cycle.
19106603 Spy1 fulfills a novel regulatory role in the intrinsic DNA damage response and maintains the balance between checkpoint activation, apoptosis, repair and cell cycle progression in response to exogenous or intrinsic damage.
17671428 Spy1 expression enhances CDK2-dependent p27 degradation during late G1 and throughout S-phase
16951407 This study reports that Spy1 expression allows cells to evade checkpoints and apoptosis and suggest that Spy1 regulation of CDK2 is important for the response to DNA damage.
12839962 This protein mediates protection of mammalian cells against DNA damage.

AA Sequence

GSEVVNDHQSNKGKKTNFLKKDKSMEWFTGSEE                                         281 - 313

Text Mined References (20)

PMID Year Title
26644004 2016 Spy1 participates in the proliferation and apoptosis of epithelial ovarian cancer.
26017671 2015 Spy1 induces de-ubiquitinating of RIP1 arrest and confers glioblastoma's resistance to tumor necrosis factor (TNF-?)-induced apoptosis through suppressing the association of CLIPR-59 and CYLD.
25526860 2016 CRMP1 Interacted with Spy1 During the Collapse of Growth Cones Induced by Sema3A and Acted on Regeneration After Sciatic Nerve Crush.
24434210 2014 The cyclin-like protein Spy1 regulates growth and division characteristics of the CD133+ population in human glioma.
24037419 2013 Cell adhesion to fibronectin down-regulates the expression of Spy1 and contributes to drug resistance in multiple myeloma cells.
22492278 2012 Expression of Spy1 protein in human non-Hodgkin's lymphomas is correlated with phosphorylation of p27 Kip1 on Thr187 and cell proliferation.
22447439 2012 Spy1 is frequently overexpressed in malignant gliomas and critically regulates the proliferation of glioma cells.
19686732 2009 Expression and prognostic role of Spy1 as a novel cell cycle protein in hepatocellular carcinoma.
19622356 2009 Cell cycle regulation of the mammalian CDK activator RINGO/Speedy A.
19106603 2009 The atypical CDK activator Spy1 regulates the intrinsic DNA damage response and is dependent upon p53 to inhibit apoptosis.
17671428 2007 Spy1 enhances phosphorylation and degradation of the cell cycle inhibitor p27.
16951407 2006 Spy1 expression prevents normal cellular responses to DNA damage: inhibition of apoptosis and checkpoint activation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15611625 2005 Identification and comparative analysis of multiple mammalian Speedy/Ringo proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12972555 2003 Spy1 interacts with p27Kip1 to allow G1/S progression.
12839962 2003 Human Spy1 promotes survival of mammalian cells following DNA damage.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11980914 2002 Human Speedy: a novel cell cycle regulator that enhances proliferation through activation of Cdk2.