Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Synonym

Accession Q5MJ10 Q0ZNM2
Symbols CT11.7
SPANX-N2

Gene

 Compartment GO Term (2)

 GWAS Trait (1)

AA Sequence

MEQPTSSTNGEKRKSPCESNNKKNDEMQEAPNRVLAPKQSLQKTKTIEYLTIIVYYYRKHTKINSNQLEK      1 - 70
DQSRENSINPVQEEEDEGLDSAEGSSQEDEDLDSSEGSSQEDEDLDSSEGSSQEDEDLDSSEGSSQEDED     71 - 140
LDSSEGSSQEDEDLDPPEGSSQEDEDLDSSEGSSQEGGED                                  141 - 180
//

Text Mined References (4)

PMID Year Title