Property Summary

NCBI Gene PubMed Count 3
Grant Count 1
Funding $124,938
PubMed Score 0.05

Knowledge Summary

Patent

No data available

AA Sequence

MEEPTSSTNENKMKSPCESNKRKVDKKKKNLHRASAPEQSLKETEKAKYPTLVFYCRKNKKRNSNQLENN      1 - 70
QPTESSTDPIKEKGDLDISAGSPQDGGQN                                              71 - 99
//

Publication (6)

PMID Year Title
17012309 2006 Hominoid-specific SPANXA/D genes demonstrate differential expression in individuals and protein localization to a distinct nuclear envelope domain during spermatid morphogenesis.
16251457 2005 Dynamic structure of the SPANX gene cluster mapped to the prostate cancer susceptibility locus HPCX at Xq27.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14973187 2004 The SPANX gene family of cancer/testis-specific antigens: rapid evolution and amplification in African great apes and hominids.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.