Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.05

Knowledge Summary

Patent

No data available

AA Sequence

MEEPTSSTNENKMKSPCESNKRKVDKKKKNLHRASAPEQSLKETEKAKYPTLVFYCRKNKKRNSNQLENN      1 - 70
QPTESSTDPIKEKGDLDISAGSPQDGGQN                                              71 - 99
//

Text Mined References (6)

PMID Year Title