Property Summary

NCBI Gene PubMed Count 2
Grant Count 1
Funding $124,938
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5MJ07
Symbols CT11.10
SPANX-N5

Gene

 Grant Application (1)

AA Sequence

MEKPTSSTNGEKRKSPCDSNSKNDEMQETPNRDLVLEPSLKKMKTSEYSTVLVLCYRKTKKIHSNQLEND      1 - 70
QS                                                                         71 - 72
//

Text Mined References (3)

PMID Year Title
17012309 2006 Hominoid-specific SPANXA/D genes demonstrate differential expression in individuals and protein localization to a distinct nuclear envelope domain during spermatid morphogenesis.
15772651 2005 The DNA sequence of the human X chromosome.
14973187 2004 The SPANX gene family of cancer/testis-specific antigens: rapid evolution and amplification in African great apes and hominids.