Property Summary

NCBI Gene PubMed Count 16
PubMed Score 28.83
PubTator Score 3.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Metabolic syndrome X 52 0.0 3.0
Disease Target Count Z-score Confidence
Teratocarcinoma 8 4.32 2.2

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.088 1.9e-05
Breast cancer -1.600 2.8e-12
chronic rhinosinusitis -1.025 1.8e-02
gastric cancer 1.200 7.8e-04
hepatocellular carcinoma 1.300 1.1e-06
juvenile dermatomyositis 1.142 1.3e-10
malignant mesothelioma 2.100 6.1e-08
osteosarcoma -2.927 3.4e-09
ovarian cancer -1.600 2.0e-04
psoriasis -2.000 1.3e-03
spina bifida -1.421 3.1e-02

Gene RIF (1)

AA Sequence

MSDTRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLI      1 - 70
VWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVEVTQDLIDESEEERFEEMPETSHLIDLPTCELN     71 - 140
KLEEIADLVTSVLSSPIRREKLALALENEGYIKKLLQLFQACENLENTEGLHHLYEIIRGILFLNKATLF    141 - 210
EVMFSDECIMDVVGCLEYDPALAQPKRHREFLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTP    211 - 280
SVFEENFLSTLTSFIFFNKVEIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEFCAFSQTLQPQ    281 - 350
NRDAFFKTLAKLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVREFVMQEAQQSDDDILLINVVI    351 - 420
EQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTEKSEFLNFFYNHCMHVLTAPLLTNTSEDKCEKD    421 - 490
FFLKHYRYSWSFICTPSHSHSHSTPSSSISQDNIVGSNKNNTICPDNYQTAQLLALILELLTFCVEHHTY    491 - 560
HIKNYIMNKDLLRRVLVLMNSKHTFLALCALRFMRRIIGLKDEFYNRYITKGNLFEPVINALLDNGTRYN    561 - 630
LLNSAVIELFEFIRVEDIKSLTAHIVENFYKALESIEYVQTFKGLKTKYEQEKDRQNQKLNSVPSILRSN    631 - 700
RFRRDAKALEEDEEMWFNEDEEEEGKAVVAPVEKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPG    701 - 770
GFKFTFSHSASAANGTNSKSVVAQIPPATSNGSSSKTTNLPTSVTATKGSLVGLVDYPDDEEEDEEEESS    771 - 840
PRKRPRLGS                                                                 841 - 849
//

Text Mined References (21)

PMID Year Title