Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent (275)

Expression

Gene RIF (1)

PMID Text
19241098 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALREIRMLKQLKHPNLVNLIEVF      1 - 70
RRKRKMHLVFEYCDHTLLNELERNPNGVADGVIKSVLWQTLQALNFCHIHNCIHRDIKPENILITKQGII     71 - 140
KICDFGFAQILIPGDAYTDYVATRWYRAPELLVGDTQYGSSVDIWAIGCVFAELLTGQPLWPGKSDVDQL    141 - 210
YLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPVALNFMKGCLKMNPDDRLTCSQL    211 - 280
LESSYFDSFQEAQIKRKARNEGRNRRRQQQAPKSAFPRLFLKTKICQVQRNETQTSGNQILPNGPILQNS    281 - 350
MVTVMTNINSAVYQVTVLHLLSENFEVKS                                             351 - 379
//

Text Mined References (4)

PMID Year Title
19241098 2009 Novel mutations in the CDKL5 gene, predicted effects and associated phenotypes.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.