Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.77
PubTator Score 3.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.700 8.0e-04
atypical teratoid / rhabdoid tumor -1.700 5.3e-08
ependymoma -1.100 5.3e-03
glioblastoma -1.400 5.2e-07
medulloblastoma, large-cell -1.600 4.9e-05
ovarian cancer -1.100 4.5e-06
primitive neuroectodermal tumor -1.300 4.7e-04
sonic hedgehog group medulloblastoma -1.100 1.6e-02

Gene RIF (6)

AA Sequence

MPPVSRSSYSEDIVGSRRRRRSSSGSPPSPQSRCSSWDGCSRSHSRGREGLRPPWSELDVGALYPFSRSG      1 - 70
SRGRLPRFRNYAFASSWSTSYSGYRYHRHCYAEERQSAEDYEKEESHRQRRLKERERIGELGAPEVWGPS     71 - 140
PKFPQLDSDEHTPVEDEEEVTHQKSSSSDSNSEEHRKKKTSRSRNKKKRKNKSSKRKHRKYSDSDSNSES    141 - 210
DTNSDSDDDKKRVKAKKKKKKKKHKTKKKKNKKTKKESSDSSCKDSEEDLSEATWMEQPNVADTMDLIGP    211 - 280
EAPIIHTSQDEKPLKYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIGSFECSGYVMSGSRHRRME    281 - 350
AVRLRKENQIYSADEKRALASFNQEERRKRESKILASFREMVHKKTKEKDDK                      351 - 402
//

Text Mined References (10)

PMID Year Title