Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.73
PubTator Score 3.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (5)

PMID Text
26297123 further evidence for the involvement of NKAPL polymorphisms in the development of schizophrenia.
25875095 Overexpression of NKAPL in germline stem cells demonstrated that Nkapl induced changes in spermatogonial stem cell (SSC) markers and the reduction of differentiation factors through the Notch signaling pathway.
24972756 Study suggested that rs1635 in the NKAPL gene appeared to play a role in conferring susceptibility to schizophrenia
23223422 Fine-mapping analyses identified six NKAPL locus variants in a single haplotype block showing association with rheumatoid arthritis.
22037552 aFfew qef w wrg egre

AA Sequence

MPPVSRSSYSEDIVGSRRRRRSSSGSPPSPQSRCSSWDGCSRSHSRGREGLRPPWSELDVGALYPFSRSG      1 - 70
SRGRLPRFRNYAFASSWSTSYSGYRYHRHCYAEERQSAEDYEKEESHRQRRLKERERIGELGAPEVWGPS     71 - 140
PKFPQLDSDEHTPVEDEEEVTHQKSSSSDSNSEEHRKKKTSRSRNKKKRKNKSSKRKHRKYSDSDSNSES    141 - 210
DTNSDSDDDKKRVKAKKKKKKKKHKTKKKKNKKTKKESSDSSCKDSEEDLSEATWMEQPNVADTMDLIGP    211 - 280
EAPIIHTSQDEKPLKYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIGSFECSGYVMSGSRHRRME    281 - 350
AVRLRKENQIYSADEKRALASFNQEERRKRESKILASFREMVHKKTKEKDDK                      351 - 402
//

Text Mined References (9)

PMID Year Title
26297123 2015 Further evidence supporting the association of NKAPL with schizophrenia.
25875095 2015 A novel transcriptional factor Nkapl is a germ cell-specific suppressor of Notch signaling and is indispensable for spermatogenesis.
24972756 2014 Resequencing and association study of the NFKB activating protein-like gene (NKAPL) in schizophrenia.
23223422 2013 Identification of the NF-?B activating protein-like locus as a risk locus for rheumatoid arthritis.
22037552 2011 Genome-wide association study identifies a susceptibility locus for schizophrenia in Han Chinese at 11p11.2.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.