Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.67
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 3.1e-34
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Mixed connective tissue disease 16 3.211 1.6
Takayasu's arteritis 53 3.072 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 2.400 3.1e-34

AA Sequence

MESKAWESNNEDLLSSSGVTSNGGSSSSFFVSSIRGTIIENTSSAGTLTQVPFFPKYEVELDSPRKIIPS      1 - 70
PGKEHFERVLEEYSHQVKDLQRRLNESNELHEKQKFYLRQSVIDLQTKLQEMQMERDAMADIRRRESQSQ     71 - 140
EDLRNQLQNTVHELEAAKCLKEDMLKDSNTQIEQLRKMMLSHEGVLQEIRSILVDFEEASGKKICEHDSM    141 - 210
STLHFRSLGSAISKILRELDTEISYLKGRIFPVEDQLEALKSESQNKIELLLQQHQDRIEQLISEHEVEI    211 - 280
TGLTEKASSARSQANSIQSQMEIIQEQARNQNSMYMRQLSDLESTVSQLRSELREAKRMYEDKTEELEKQ    281 - 350
LVLANSELTEARTERDQFSQESGNLDDQLQKLLADLHKREKELSLEKEQNKRLWDRDTGNSITIDHLRRE    351 - 420
LDNRNMEVQRLEALLKALKSECQGQMERQMAAIQGKNESLEKVSSLTAQLESTKEMLRKVVEELTAKKMT    421 - 490
LESSERTISDLTTSLQEKERAIEATNAEITKLRSRVDLKLQELQHLKNEGDHLRNVQTECEALKLQMTEK    491 - 560
DKVIEILRQQIENMTQLVGQHGRTAGAMQVEKAQLEKEINDRRMELKELKILKDKKDAKIRELEARVSDL    561 - 630
ELEKVKLVNAGSERLRAVKDIKQERDQLLNEVKTSRSELNNLSEEYEVLKRNFRNKSEEMEMTTNKLKMQ    631 - 700
LKSAQSELEQTRNTLKSMEGSDGHAMKVAMGMQKQITAKRGQIDALQSKIQFLEEAMTNANKEKHFLKEE    701 - 770
KSKLSQELSTVATEKNKMAGELEVLRSQERRLKEKVTNMEVALDKASLQFAECQDIIQRQEQESVRLKLQ    771 - 840
HTLDIKELQGPGYTSNSSLKPRLLQPASVTRSHSNVPSSQSTASFLSHHSTKANTLKEDPTRDLKQLLQE    841 - 910
LRSVINEEPAVSLSKTEEDGRTSLGALEDRVRDCITESSLRSDMCHRSNNSLRDSTEGSKSSETLSREPV    911 - 980
TLHAGDREDPSGCFTFTSAASPSVKNSASRSFNSSPKKSPVHSLLTSSVEGSIGSTSQYRSAKPIHSSDS    981 - 1050
VKDSQSPPIETTGKTCRKLQNRLESLQTLVEDLQLKNQAMSSMIRNQEKRIQKVKDQEKMLLK          1051 - 1113
//

Text Mined References (7)

PMID Year Title