Property Summary

NCBI Gene PubMed Count 2
Grant Count 4
R01 Count 2
Funding $463,154
PubMed Score 4.22
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.989 0.000
atypical teratoid / rhabdoid tumor 1.800 0.009
lung carcinoma 4.000 0.000
ovarian cancer 1.500 0.034
psoriasis -1.600 0.000

Gene RIF (1)

PMID Text
24550737 Our results suggest that the SLC35D3 gene, close to the D6S1009 locus, is a candidate gene for MetS, which is involved in metabolic control in the central nervous system by regulating dopamine signaling.

AA Sequence

MRQLCRGRVLGISVAIAHGVFSGSLNILLKFLISRYQFSFLTLVQCLTSSTAALSLELLRRLGLIAVPPF      1 - 70
GLSLARSFAGVAVLSTLQSSLTLWSLRGLSLPMYVVFKRCLPLVTMLIGVLVLKNGAPSPGVLAAVLITT     71 - 140
CGAALAGAGDLTGDPIGYVTGVLAVLVHAAYLVLIQKASADTEHGPLTAQYVIAVSATPLLVICSFASTD    141 - 210
SIHAWTFPGWKDPAMVCIFVACILIGCAMNFTTLHCTYINSAVTTSFVGVVKSIATITVGMVAFSDVEPT    211 - 280
SLFIAGVVVNTLGSIIYCVAKFMETRKQSNYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGE    281 - 350
AAGGPAQESRQEVRGSPRGVPLVAGSSEEGSRRSLKDAYLEVWRLVRGTRYMKKDYLIENEELPSP        351 - 416
//

Text Mined References (5)

PMID Year Title
24550737 2014 Mutation of SLC35D3 causes metabolic syndrome by impairing dopamine signaling in striatal D1 neurons.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.